General information for g2628.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Multidrug resistance-associated protein 4.
Parent gene
- The parent gene g2628 is located on chr_3: 19181395..19182668 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2628 | g2628.t3 | TTS | g2628.t3 | 19180386 | 19180386 |
| chr_3 | g2628 | g2628.t3 | isoform | g2628.t3 | 19181395 | 19181927 |
| chr_3 | g2628 | g2628.t3 | exon | g2628.t3.exon1 | 19181395 | 19181927 |
| chr_3 | g2628 | g2628.t3 | cds | g2628.t3.CDS1 | 19181397 | 19181900 |
| chr_3 | g2628 | g2628.t3 | TSS | g2628.t3 | 19182679 | 19182679 |
Sequences
>g2628.t3 Gene=g2628 Length=533
ATTTCAGTTATTGTGAAAGAATTCATTATGAATTCACAAAATTCAAAACAAAAGCCAGAA
AATCCTCTACAGAATGCATCTCGATTGAGCAGAATGACATTTTGGTGGCTTAAAGATCTG
TATAAAATTGGTATGACACGACCAATTACGGACGATGATGTTTATCAGACAATTGACCAT
CATGAATGTGATCGAATAGCAAACAAATTTAAAACGTTATGGCAGAAGGAACTTGATGGA
TCAAAAAGACCAAGTGCACTTAGATTAATTTACAATGCTTATGGACCGCCTGTACTGATA
ATTGGATTACTTTTCTCGGTCTGTGAAACGTTGATGCGTTGTGCACAGCCGTTGTTGCTA
GGTGAACTTCTTACTTATTTTGCTGATGAAAGTGCATCGAAAGAATGGGCATATATTTAC
GCAGCAGGAATTGTTATATGCTCGATTGTTCCTGTAATAACATTCCATCCATTTATCTAT
TACATTTTTGAAATTGGAATGAAAATAAGAATTGGCTGCTCAAGATTAGTTTA
>g2628.t3 Gene=g2628 Length=168
MNSQNSKQKPENPLQNASRLSRMTFWWLKDLYKIGMTRPITDDDVYQTIDHHECDRIANK
FKTLWQKELDGSKRPSALRLIYNAYGPPVLIIGLLFSVCETLMRCAQPLLLGELLTYFAD
ESASKEWAYIYAAGIVICSIVPVITFHPFIYYIFEIGMKIRIGCSRLV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g2628.t3 | PANTHER | PTHR24223 | ATP-BINDING CASSETTE SUB-FAMILY C | 3 | 167 | 1.9E-34 |
| 2 | g2628.t3 | PANTHER | PTHR24223:SF324 | LD17001P | 3 | 167 | 1.9E-34 |
| 7 | g2628.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 88 | - |
| 10 | g2628.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 89 | 110 | - |
| 8 | g2628.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 111 | 129 | - |
| 9 | g2628.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 154 | - |
| 6 | g2628.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 155 | 168 | - |
| 5 | g2628.t3 | SUPERFAMILY | SSF90123 | ABC transporter transmembrane region | 86 | 163 | 1.83E-7 |
| 3 | g2628.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 102 | - |
| 4 | g2628.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 129 | 151 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005524 | ATP binding | MF |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
