General information for g2854.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Organic cation transporter protein.
Parent gene
- The parent gene g2854 is located on chr_3: 20666950..20668009 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2854 | g2854.t3 | isoform | g2854.t3 | 20666950 | 20668009 |
| chr_3 | g2854 | g2854.t3 | exon | g2854.t3.exon1 | 20666950 | 20667132 |
| chr_3 | g2854 | g2854.t3 | cds | g2854.t3.CDS1 | 20667024 | 20667132 |
| chr_3 | g2854 | g2854.t3 | exon | g2854.t3.exon2 | 20667193 | 20667497 |
| chr_3 | g2854 | g2854.t3 | cds | g2854.t3.CDS2 | 20667193 | 20667497 |
| chr_3 | g2854 | g2854.t3 | exon | g2854.t3.exon3 | 20667566 | 20668009 |
| chr_3 | g2854 | g2854.t3 | cds | g2854.t3.CDS3 | 20667566 | 20668009 |
| chr_3 | g2854 | g2854.t3 | TTS | g2854.t3 | 20668035 | 20668035 |
| chr_3 | g2854 | g2854.t3 | TSS | g2854.t3 | NA | NA |
Sequences
>g2854.t3 Gene=g2854 Length=932
GTTTAGAATTAGTCACACCACAACTGAGAACAATTTCCGGTACAATTCTCAACTGCTTTT
ATGCTCTTGGTGGAATGATTCTTGGTCTCGTAGCAATGTGGCTGCGTAATTACAAATCAC
TATTATTTGTCACATATATTCCTGCATTCATCGTCATTGCATACACTTGGTTGCTTCCTC
AAAGCATAAGATGGCTTTTATCAGAAGGAAGGCACGAAGATGCAAAGATAGTGCTGCGGA
AAGCTTGCAAGTTAAACGGAACTGAAATGAGTGTGCAAACATTAAATTCATTAGATGAGA
AAATTCAAATGCAAAATTCAAACAACAATACGCTTGAGAGCGCTTCAAAGTCAGAAAAGA
TTTCTATCCGTGCTGTGCTGCAAATTACTAATCTCTCATACTGTTGGTTTGCAACCATCT
TCGTTTATTATGGACTCAACTTGAACTCTGTCTATCTCGAGTATTGGAACAAATACATAA
ATTTCATTTTTGTGTGTGCCATTGAATTGCCCGGATACTTTATAACAAACATCCTAATGG
AGAAACTTGGTCGAAAGAAAACGCTTTTTCTTGGTATGATTGGAAGTGGACTTTTCTGCA
TTCTTGCTGATGTCGTACCGGGCAGTGTTAATAAGACAATCTTTTATGTGTGCGGAAAAT
TGCTCATAACAATCTCATTCAGTTGTCTTTATATCTTTACAATTGAAATTTTTCCCACCT
CGTTACGACAGCGTTTTTTCTCTATCTGCAGTATTGTTGGTCGTCTTGGCTCCATTTTAA
CAATGTCAACTCCACTTTTAATTGAAATATATCCTAGTCTTCCTTTGATTCTCTTTTCAA
GTCTCTCATTTAGTTCAGCTATATTTCTTTGGTCACTTCCTGAAACATTAAATCGACGTT
TACCCGAAACTATGAAGGAAGCTTTTAATTAA
>g2854.t3 Gene=g2854 Length=285
MILGLVAMWLRNYKSLLFVTYIPAFIVIAYTWLLPQSIRWLLSEGRHEDAKIVLRKACKL
NGTEMSVQTLNSLDEKIQMQNSNNNTLESASKSEKISIRAVLQITNLSYCWFATIFVYYG
LNLNSVYLEYWNKYINFIFVCAIELPGYFITNILMEKLGRKKTLFLGMIGSGLFCILADV
VPGSVNKTIFYVCGKLLITISFSCLYIFTIEIFPTSLRQRFFSICSIVGRLGSILTMSTP
LLIEIYPSLPLILFSSLSFSSAIFLWSLPETLNRRLPETMKEAFN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g2854.t3 | Coils | Coil | Coil | 70 | 90 | - |
| 12 | g2854.t3 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains | 1 | 284 | 2.0E-41 |
| 2 | g2854.t3 | PANTHER | PTHR24064 | SOLUTE CARRIER FAMILY 22 MEMBER | 2 | 284 | 4.3E-79 |
| 3 | g2854.t3 | PANTHER | PTHR24064:SF335 | FI24011P1-RELATED | 2 | 284 | 4.3E-79 |
| 1 | g2854.t3 | Pfam | PF00083 | Sugar (and other) transporter | 12 | 278 | 1.3E-17 |
| 21 | g2854.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 14 | - |
| 28 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 34 | - |
| 15 | g2854.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 35 | 99 | - |
| 27 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 121 | - |
| 19 | g2854.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 122 | 132 | - |
| 26 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 133 | 151 | - |
| 14 | g2854.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 152 | 162 | - |
| 22 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 163 | 182 | - |
| 18 | g2854.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 183 | 187 | - |
| 25 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 188 | 209 | - |
| 17 | g2854.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 210 | 220 | - |
| 23 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 20 | g2854.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 244 | 248 | - |
| 24 | g2854.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 249 | 268 | - |
| 16 | g2854.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 269 | 285 | - |
| 11 | g2854.t3 | SUPERFAMILY | SSF103473 | MFS general substrate transporter | 3 | 278 | 5.62E-23 |
| 10 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 34 | - |
| 5 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 119 | - |
| 6 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 156 | - |
| 9 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 163 | 185 | - |
| 8 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 189 | 208 | - |
| 4 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 7 | g2854.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 247 | 269 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055085 | transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0022857 | transmembrane transporter activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
