| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2894 | g2894.t4 | isoform | g2894.t4 | 20955967 | 20966788 |
| chr_3 | g2894 | g2894.t4 | exon | g2894.t4.exon1 | 20955967 | 20955986 |
| chr_3 | g2894 | g2894.t4 | cds | g2894.t4.CDS1 | 20955968 | 20955986 |
| chr_3 | g2894 | g2894.t4 | exon | g2894.t4.exon2 | 20956057 | 20956172 |
| chr_3 | g2894 | g2894.t4 | cds | g2894.t4.CDS2 | 20956057 | 20956172 |
| chr_3 | g2894 | g2894.t4 | exon | g2894.t4.exon3 | 20956299 | 20956414 |
| chr_3 | g2894 | g2894.t4 | cds | g2894.t4.CDS3 | 20956299 | 20956414 |
| chr_3 | g2894 | g2894.t4 | exon | g2894.t4.exon4 | 20957287 | 20957404 |
| chr_3 | g2894 | g2894.t4 | cds | g2894.t4.CDS4 | 20957287 | 20957404 |
| chr_3 | g2894 | g2894.t4 | exon | g2894.t4.exon5 | 20966771 | 20966788 |
| chr_3 | g2894 | g2894.t4 | cds | g2894.t4.CDS5 | 20966771 | 20966788 |
| chr_3 | g2894 | g2894.t4 | TSS | g2894.t4 | 20967308 | 20967308 |
| chr_3 | g2894 | g2894.t4 | TTS | g2894.t4 | NA | NA |
>g2894.t4 Gene=g2894 Length=388
ATGCCATCATTGCAACAGACATCAACATTTAAAGATTGTAATCTGTCATCAGAAATTCTT
CAAAAACATTCAATAAACTCTATTAATTCACTCTTAAATAACGAAGATGGCTTGATTTTA
TCTCCTCATTCAGAAGTAGATCCTAATCTAATTTTTGGTGACATGTTTCACACAGCTACT
CCAAAAGGATATTCATCACCTGACAGGAACTATATTCAGACAACTCCACCAAAAATGTTT
GAAAATTTTCAGTTTGACAATCGTTCAATACAACGAAATTTAAGTTTTGACTGCAATGTC
ACAACTCCGACTTCACCGGGAACACCTAGTTCTTTTAAAGCATACATGAATTCACCGTCT
TCATATGGAAATGATTCGGGATTTTACA
>g2894.t4 Gene=g2894 Length=129
MPSLQQTSTFKDCNLSSEILQKHSINSINSLLNNEDGLILSPHSEVDPNLIFGDMFHTAT
PKGYSSPDRNYIQTTPPKMFENFQFDNRSIQRNLSFDCNVTTPTSPGTPSSFKAYMNSPS
SYGNDSGFY
No InterPro annotations for this transcript.
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed