Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g2894 g2894.t4 isoform g2894.t4 20955967 20966788
chr_3 g2894 g2894.t4 exon g2894.t4.exon1 20955967 20955986
chr_3 g2894 g2894.t4 cds g2894.t4.CDS1 20955968 20955986
chr_3 g2894 g2894.t4 exon g2894.t4.exon2 20956057 20956172
chr_3 g2894 g2894.t4 cds g2894.t4.CDS2 20956057 20956172
chr_3 g2894 g2894.t4 exon g2894.t4.exon3 20956299 20956414
chr_3 g2894 g2894.t4 cds g2894.t4.CDS3 20956299 20956414
chr_3 g2894 g2894.t4 exon g2894.t4.exon4 20957287 20957404
chr_3 g2894 g2894.t4 cds g2894.t4.CDS4 20957287 20957404
chr_3 g2894 g2894.t4 exon g2894.t4.exon5 20966771 20966788
chr_3 g2894 g2894.t4 cds g2894.t4.CDS5 20966771 20966788
chr_3 g2894 g2894.t4 TSS g2894.t4 20967308 20967308
chr_3 g2894 g2894.t4 TTS g2894.t4 NA NA

Sequences

>g2894.t4 Gene=g2894 Length=388
ATGCCATCATTGCAACAGACATCAACATTTAAAGATTGTAATCTGTCATCAGAAATTCTT
CAAAAACATTCAATAAACTCTATTAATTCACTCTTAAATAACGAAGATGGCTTGATTTTA
TCTCCTCATTCAGAAGTAGATCCTAATCTAATTTTTGGTGACATGTTTCACACAGCTACT
CCAAAAGGATATTCATCACCTGACAGGAACTATATTCAGACAACTCCACCAAAAATGTTT
GAAAATTTTCAGTTTGACAATCGTTCAATACAACGAAATTTAAGTTTTGACTGCAATGTC
ACAACTCCGACTTCACCGGGAACACCTAGTTCTTTTAAAGCATACATGAATTCACCGTCT
TCATATGGAAATGATTCGGGATTTTACA

>g2894.t4 Gene=g2894 Length=129
MPSLQQTSTFKDCNLSSEILQKHSINSINSLLNNEDGLILSPHSEVDPNLIFGDMFHTAT
PKGYSSPDRNYIQTTPPKMFENFQFDNRSIQRNLSFDCNVTTPTSPGTPSSFKAYMNSPS
SYGNDSGFY

Protein features from InterProScan

No InterPro annotations for this transcript.

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed