General information for g2903.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative ATP synthase-coupling factor 6, mitochondrial.
Parent gene
- The parent gene g2903 is located on chr_3: 21043279..21044820 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g2903 | g2903.t1 | TSS | g2903.t1 | 21042651 | 21042651 |
| chr_3 | g2903 | g2903.t1 | isoform | g2903.t1 | 21042893 | 21043279 |
| chr_3 | g2903 | g2903.t1 | exon | g2903.t1.exon1 | 21042893 | 21043044 |
| chr_3 | g2903 | g2903.t1 | cds | g2903.t1.CDS1 | 21042893 | 21043044 |
| chr_3 | g2903 | g2903.t1 | exon | g2903.t1.exon2 | 21043108 | 21043279 |
| chr_3 | g2903 | g2903.t1 | cds | g2903.t1.CDS2 | 21043108 | 21043279 |
| chr_3 | g2903 | g2903.t1 | TTS | g2903.t1 | 21043413 | 21043413 |
Sequences
>g2903.t1 Gene=g2903 Length=324
ATGTTGACCTCTCAGCTATTGTCTGGCGTTCGCAATTTAGGCCAAGTTGCCCGCCGTAAT
TTTGGAATCGCTGCTCCTGCACTTCAAAAAGTTTCTGATCCAATTCAACAATTGTTCCTT
GACAAAATTCGTGAATACAAATCCAAGAGCGCTGGCGGCAAATTAGTTGATGCAACACCT
GAAATCCAACGTGAATTAGCACAAGAATTGGACAAACTGGCAAAGCAATACGGTGGTGGC
GATGGTGTTGATATGACTAAATTCCCGGAATTCAAATTTCAAGATCCAAAAATAGATCCA
ATCAATGCTGAAAGTGCTAACTAA
>g2903.t1 Gene=g2903 Length=107
MLTSQLLSGVRNLGQVARRNFGIAAPALQKVSDPIQQLFLDKIREYKSKSAGGKLVDATP
EIQRELAQELDKLAKQYGGGDGVDMTKFPEFKFQDPKIDPINAESAN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g2903.t1 | Gene3D | G3DSA:1.10.246.110 | - | 35 | 99 | 0 |
| 2 | g2903.t1 | PANTHER | PTHR12441 | ATP SYNTHASE COUPLING FACTOR 6, MITOCHONDRIAL | 16 | 102 | 0 |
| 3 | g2903.t1 | PANTHER | PTHR12441:SF10 | ATP SYNTHASE-COUPLING FACTOR 6, MITOCHONDRIAL | 16 | 102 | 0 |
| 6 | g2903.t1 | PIRSF | PIRSF002455 | ATP_synth_F6 | 1 | 105 | 0 |
| 1 | g2903.t1 | Pfam | PF05511 | Mitochondrial ATP synthase coupling factor 6 | 12 | 95 | 0 |
| 4 | g2903.t1 | SUPERFAMILY | SSF111357 | Mitochondrial ATP synthase coupling factor 6 | 30 | 103 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015986 | ATP synthesis coupled proton transport | BP |
| GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | CC |
| GO:0015078 | proton transmembrane transporter activity | MF |
KEGG
Orthology
- This transcript has been annotated with K02131 (F-type H+-transporting ATPase subunit 6)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
