| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3018 | g3018.t13 | TSS | g3018.t13 | 22145982 | 22145982 |
| chr_3 | g3018 | g3018.t13 | isoform | g3018.t13 | 22146768 | 22147208 |
| chr_3 | g3018 | g3018.t13 | exon | g3018.t13.exon1 | 22146768 | 22147133 |
| chr_3 | g3018 | g3018.t13 | cds | g3018.t13.CDS1 | 22146796 | 22147133 |
| chr_3 | g3018 | g3018.t13 | exon | g3018.t13.exon2 | 22147187 | 22147208 |
| chr_3 | g3018 | g3018.t13 | cds | g3018.t13.CDS2 | 22147187 | 22147208 |
| chr_3 | g3018 | g3018.t13 | TTS | g3018.t13 | 22148011 | 22148011 |
>g3018.t13 Gene=g3018 Length=388
AATTCAAGTCAAATGTTTTCAAGAAATAATGCAGATTGGATTTGTTACCTATAGAGTTGA
TGAAATTCCATGGTTTCGGCATTTAACTTGGTATTTATTGACAGTCTCCAACTATTATTA
TTATGGCGAATATTTCTTCGATTATTTTGGACCACCACTCAATCGTATAGAATCACTACA
ATTCTTAATTAAATCACATCGCTTCATTTCCTATTGTCTCTATCTCTTTGCAATAATAAT
GTTTGTATTGTCACTCGTTAAGAAATACAATACTAGACAATTTCATCTGTTTGCATGGGC
GCATGTCGCTTTATTGATCACTGTCGTTCCAAGCTATCTTATCATAAGAAACACGTTCGA
TGGTGAGATTGATTTGGTTCATCATACC
>g3018.t13 Gene=g3018 Length=120
MQIGFVTYRVDEIPWFRHLTWYLLTVSNYYYYGEYFFDYFGPPLNRIESLQFLIKSHRFI
SYCLYLFAIIMFVLSLVKKYNTRQFHLFAWAHVALLITVVPSYLIIRNTFDGEIDLVHHT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g3018.t13 | PANTHER | PTHR13773:SF16 | PHOSPHATIDATE CYTIDYLYLTRANSFERASE 1 | 2 | 115 | 5.0E-33 |
| 2 | g3018.t13 | PANTHER | PTHR13773 | PHOSPHATIDATE CYTIDYLYLTRANSFERASE | 2 | 115 | 5.0E-33 |
| 8 | g3018.t13 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 58 | - |
| 10 | g3018.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 77 | - |
| 6 | g3018.t13 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 78 | 88 | - |
| 9 | g3018.t13 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 89 | 106 | - |
| 7 | g3018.t13 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 107 | 120 | - |
| 5 | g3018.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 32 | - |
| 4 | g3018.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 58 | 77 | - |
| 3 | g3018.t13 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004605 | phosphatidate cytidylyltransferase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed