General information for g3021.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative STAM-binding protein.
Parent gene
- The parent gene g3021 is located on chr_3: 22171600..22171940 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3021 | g3021.t2 | TSS | g3021.t2 | 22170493 | 22170493 |
| chr_3 | g3021 | g3021.t2 | isoform | g3021.t2 | 22170555 | 22171044 |
| chr_3 | g3021 | g3021.t2 | exon | g3021.t2.exon1 | 22170555 | 22170670 |
| chr_3 | g3021 | g3021.t2 | cds | g3021.t2.CDS1 | 22170555 | 22170670 |
| chr_3 | g3021 | g3021.t2 | exon | g3021.t2.exon2 | 22170746 | 22171044 |
| chr_3 | g3021 | g3021.t2 | cds | g3021.t2.CDS2 | 22170746 | 22171043 |
| chr_3 | g3021 | g3021.t2 | TTS | g3021.t2 | 22171996 | 22171996 |
Sequences
>g3021.t2 Gene=g3021 Length=415
ATGGCAGATCTTATTAATTTTAATCAAATGGGGATTGTAGAACCTGAAAAGCGGTTAAAA
CAATTAAATGAGTCAGGTTCAAATATAAATGTCGATAAGAACCAGAATATCTTGAGATAT
TATAGATCTGGTAATGAAATATATAGAATGGCAAAAATATACATGCAAGAAGGAAATCAT
GAAAATGCGTACATCTTATTCCTAAGATTTTTAACTTTATTTGTTGAAAAGATAAGAGAA
CATCCTAATTATAAAGAAGTACCAGCTGATTTCAAAAAATCTAACAAAGAGAAAATGACA
GAAATTATGACATTAACAGAAAAATTGAAGGCGAAACTATTGGATCGTTATAAAAAAGAA
TACGAACAATTTTTAATTGATCAAGAGAATGAGCGAAAGAAAGCGATTGAGGAAG
>g3021.t2 Gene=g3021 Length=138
MADLINFNQMGIVEPEKRLKQLNESGSNINVDKNQNILRYYRSGNEIYRMAKIYMQEGNH
ENAYILFLRFLTLFVEKIREHPNYKEVPADFKKSNKEKMTEIMTLTEKLKAKLLDRYKKE
YEQFLIDQENERKKAIEE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3021.t2 | Coils | Coil | Coil | 114 | 138 | - |
| 5 | g3021.t2 | Gene3D | G3DSA:1.20.58.280 | Hypothetical protein 1500032h18. | 8 | 138 | 1.1E-40 |
| 2 | g3021.t2 | PANTHER | PTHR12947 | AMSH-LIKE PROTEASE | 13 | 134 | 1.9E-22 |
| 3 | g3021.t2 | PANTHER | PTHR12947:SF7 | AMSH-LIKE PROTEASE | 13 | 134 | 1.9E-22 |
| 1 | g3021.t2 | Pfam | PF08969 | USP8 dimerisation domain | 16 | 119 | 1.5E-28 |
| 4 | g3021.t2 | SUPERFAMILY | SSF140856 | USP8 N-terminal domain-like | 18 | 131 | 1.7E-14 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed