| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3031 | g3031.t1 | isoform | g3031.t1 | 22216905 | 22218251 |
| chr_3 | g3031 | g3031.t1 | exon | g3031.t1.exon1 | 22216905 | 22217139 |
| chr_3 | g3031 | g3031.t1 | cds | g3031.t1.CDS1 | 22216905 | 22217139 |
| chr_3 | g3031 | g3031.t1 | exon | g3031.t1.exon2 | 22217199 | 22217379 |
| chr_3 | g3031 | g3031.t1 | cds | g3031.t1.CDS2 | 22217199 | 22217379 |
| chr_3 | g3031 | g3031.t1 | exon | g3031.t1.exon3 | 22217443 | 22217784 |
| chr_3 | g3031 | g3031.t1 | cds | g3031.t1.CDS3 | 22217443 | 22217784 |
| chr_3 | g3031 | g3031.t1 | exon | g3031.t1.exon4 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t1 | cds | g3031.t1.CDS4 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t1 | exon | g3031.t1.exon5 | 22217988 | 22218251 |
| chr_3 | g3031 | g3031.t1 | cds | g3031.t1.CDS5 | 22217988 | 22218251 |
| chr_3 | g3031 | g3031.t1 | TTS | g3031.t1 | 22218909 | 22218909 |
| chr_3 | g3031 | g3031.t1 | TSS | g3031.t1 | NA | NA |
>g3031.t1 Gene=g3031 Length=1095
ATGGCTCCGCGTGAAGTCGTTAAAACTTCAGAGATTTCCGTTAGTGGTGTATTGGATGAA
AATGACATCGAAACAATTGATGGAGGATTGAAACAGCCATCACAAGGATATGCTAGACGC
CGCAATTTAAAACTTGTTTGGCGCAATATTATTCTTTTTGCGTATCTTCATCTTGCTGCA
GTATATGGTTTATGGCTTATGTTAACTTCTGCAAAATGGACTACAGGAATTTTCGCAATG
ATGTTGTATTCTATGAGCGGTCTTGGAATCACAGCTGGTGCTCATCGTCTATGGGCTCAT
CGTGCATACAAAGCTAAATGGCCATTACGCATTATTCTTACTATTTTCAATACAATTGCT
TTCCAAGATTGCGCAATCCATTGGGCACGCGATCATCGAGTACATCATAAATACAGTGAA
ACTGACGCTGATCCACATAATGCAACACGCGGTTTCTTCTTCTCTCATATCGGCTGGCTC
TTGTGTCGTAAACATCCTGATGTTATTGCTGCCGGCAAGAAATTAGATATTTCCGATCTT
GAGAATGATCCAATTTTACGATTCCAAAGAAAATACTATTTGATTCTCATGCCATTGCTA
TGCTTCATCATCCCAACAATCATTCCTGTCTTCTGGTGGGGCGAAACATGGAAAAATGCA
TGGTTTGTTGCAACAATGTTCCGTTACACATTTATTCTCAATGTAACCTGGTTGGTTAAC
AGTGCAGCTCACAAATATGGTGATAAACCCTATGACAAATATATCAGTCCATCAGAGAAT
ATGTCAGTTGCTATCTTTGCTCTTGGTGAGGGATTCCACAATTACCACCATGTTTTCCCC
TGGGATTACAAAACAGCTGAACTCGGCAACTACAGAATGAATTTCACTACAGCATTTATT
GATTTCTTTGCTAAGATTGGCTGGGCTTATGATTTGAAGACCGTGTCAAATGAAATTATT
CAAAAACGTGTTGAAAGAACGGGAGATGGCACTCATAAGTCATCCAGAGATTCGACTTTA
TGGGGATATGGTGATCCAGCACAAAATGAAGAAGAAAAGAATATGATACCAATTTTACAC
AAAAAAGAAGACTAA
>g3031.t1 Gene=g3031 Length=364
MAPREVVKTSEISVSGVLDENDIETIDGGLKQPSQGYARRRNLKLVWRNIILFAYLHLAA
VYGLWLMLTSAKWTTGIFAMMLYSMSGLGITAGAHRLWAHRAYKAKWPLRIILTIFNTIA
FQDCAIHWARDHRVHHKYSETDADPHNATRGFFFSHIGWLLCRKHPDVIAAGKKLDISDL
ENDPILRFQRKYYLILMPLLCFIIPTIIPVFWWGETWKNAWFVATMFRYTFILNVTWLVN
SAAHKYGDKPYDKYISPSENMSVAIFALGEGFHNYHHVFPWDYKTAELGNYRMNFTTAFI
DFFAKIGWAYDLKTVSNEIIQKRVERTGDGTHKSSRDSTLWGYGDPAQNEEEKNMIPILH
KKED
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 20 | g3031.t1 | CDD | cd03505 | Delta9-FADS-like | 72 | 313 | 1.01426E-75 |
| 26 | g3031.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 327 | 346 | - |
| 2 | g3031.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 13 | 364 | 4.3E-187 |
| 3 | g3031.t1 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 13 | 364 | 4.3E-187 |
| 6 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 47 | 67 | 4.0E-74 |
| 5 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 72 | 94 | 4.0E-74 |
| 10 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 95 | 115 | 4.0E-74 |
| 4 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 132 | 161 | 4.0E-74 |
| 7 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 193 | 211 | 4.0E-74 |
| 9 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 226 | 247 | 4.0E-74 |
| 8 | g3031.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 269 | 283 | 4.0E-74 |
| 1 | g3031.t1 | Pfam | PF00487 | Fatty acid desaturase | 72 | 280 | 8.0E-17 |
| 12 | g3031.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 44 | - |
| 19 | g3031.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 65 | - |
| 15 | g3031.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 66 | 76 | - |
| 17 | g3031.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 98 | - |
| 11 | g3031.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 99 | 191 | - |
| 18 | g3031.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 192 | 214 | - |
| 14 | g3031.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 215 | 219 | - |
| 16 | g3031.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 220 | 239 | - |
| 13 | g3031.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 240 | 364 | - |
| 25 | g3031.t1 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 269 | 283 | - |
| 22 | g3031.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 67 | - |
| 21 | g3031.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 99 | - |
| 24 | g3031.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 192 | 214 | - |
| 23 | g3031.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 219 | 241 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.