Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g3031 g3031.t2 isoform g3031.t2 22214088 22217379
chr_3 g3031 g3031.t2 exon g3031.t2.exon1 22214088 22214235
chr_3 g3031 g3031.t2 TSS g3031.t2 22214096 22214096
chr_3 g3031 g3031.t2 exon g3031.t2.exon2 22216840 22217139
chr_3 g3031 g3031.t2 cds g3031.t2.CDS1 22216905 22217139
chr_3 g3031 g3031.t2 exon g3031.t2.exon3 22217199 22217379
chr_3 g3031 g3031.t2 cds g3031.t2.CDS2 22217199 22217377
chr_3 g3031 g3031.t2 TTS g3031.t2 22218236 22218236

Sequences

>g3031.t2 Gene=g3031 Length=629
GCAAGTTTTGTCATTAATTTCTTGATTCTTCAGAGAAGAAGTAATAAATTGTGAATAGAA
ATTTTTTAAAGCATGAAAGTGTATTAAATATACTGTGAAATTAACAAATTACAATTTATA
CACACCAAGATTTGGCAATTATTCTTGGATACACTTTTTTTGCGCAGGCAACTTTATAGT
TTATTAAAGTTTGATATTCACGATTAACAAAAAATGGCTCCGCGTGAAGTCGTTAAAACT
TCAGAGATTTCCGTTAGTGGTGTATTGGATGAAAATGACATCGAAACAATTGATGGAGGA
TTGAAACAGCCATCACAAGGATATGCTAGACGCCGCAATTTAAAACTTGTTTGGCGCAAT
ATTATTCTTTTTGCGTATCTTCATCTTGCTGCAGTATATGGTTTATGGCTTATGTTAACT
TCTGCAAAATGGACTACAGGAATTTTCGCAATGATGTTGTATTCTATGAGCGGTCTTGGA
ATCACAGCTGGTGCTCATCGTCTATGGGCTCATCGTGCATACAAAGCTAAATGGCCATTA
CGCATTATTCTTACTATTTTCAATACAATTGCTTTCCAAGATTGCGCAATCCATTGGGCA
CGCGATCATCGAGTACATCATAAATACAG

>g3031.t2 Gene=g3031 Length=138
MAPREVVKTSEISVSGVLDENDIETIDGGLKQPSQGYARRRNLKLVWRNIILFAYLHLAA
VYGLWLMLTSAKWTTGIFAMMLYSMSGLGITAGAHRLWAHRAYKAKWPLRIILTIFNTIA
FQDCAIHWARDHRVHHKY

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g3031.t2 PANTHER PTHR11351 ACYL-COA DESATURASE 13 138 2.1E-58
2 g3031.t2 PANTHER PTHR11351:SF91 DESATURASE 1, ISOFORM A-RELATED 13 138 2.1E-58
4 g3031.t2 PRINTS PR00075 Fatty acid desaturase family 1 signature 47 67 4.0E-32
3 g3031.t2 PRINTS PR00075 Fatty acid desaturase family 1 signature 72 94 4.0E-32
6 g3031.t2 PRINTS PR00075 Fatty acid desaturase family 1 signature 95 115 4.0E-32
5 g3031.t2 PRINTS PR00075 Fatty acid desaturase family 1 signature 132 138 4.0E-32
9 g3031.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 44 -
15 g3031.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 45 65 -
12 g3031.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 66 76 -
14 g3031.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 77 99 -
10 g3031.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 100 110 -
13 g3031.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 111 129 -
11 g3031.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 130 138 -
8 g3031.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 45 67 -
7 g3031.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 77 99 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values