Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g3031 g3031.t22 isoform g3031.t22 22216905 22217680
chr_3 g3031 g3031.t22 exon g3031.t22.exon1 22216905 22217139
chr_3 g3031 g3031.t22 cds g3031.t22.CDS1 22216905 22217139
chr_3 g3031 g3031.t22 exon g3031.t22.exon2 22217199 22217381
chr_3 g3031 g3031.t22 cds g3031.t22.CDS2 22217199 22217381
chr_3 g3031 g3031.t22 exon g3031.t22.exon3 22217443 22217680
chr_3 g3031 g3031.t22 cds g3031.t22.CDS3 22217443 22217552
chr_3 g3031 g3031.t22 TTS g3031.t22 22218236 22218236
chr_3 g3031 g3031.t22 TSS g3031.t22 NA NA

Sequences

>g3031.t22 Gene=g3031 Length=656
ATGGCTCCGCGTGAAGTCGTTAAAACTTCAGAGATTTCCGTTAGTGGTGTATTGGATGAA
AATGACATCGAAACAATTGATGGAGGATTGAAACAGCCATCACAAGGATATGCTAGACGC
CGCAATTTAAAACTTGTTTGGCGCAATATTATTCTTTTTGCGTATCTTCATCTTGCTGCA
GTATATGGTTTATGGCTTATGTTAACTTCTGCAAAATGGACTACAGGAATTTTCGCAATG
ATGTTGTATTCTATGAGCGGTCTTGGAATCACAGCTGGTGCTCATCGTCTATGGGCTCAT
CGTGCATACAAAGCTAAATGGCCATTACGCATTATTCTTACTATTTTCAATACAATTGCT
TTCCAAGATTGCGCAATCCATTGGGCACGCGATCATCGAGTACATCATAAATACAGGTTG
AAACTGACGCTGATCCACATAATGCAACACGCGGTTTCTTCTTCTCTCATATCGGCTGGC
TCTTGTGTCGTAAACATCCTGATGTTATTGCTGCCGGCAAGAAATTAGATATTTCCGATC
TTGAGAATGATCCAATTTTACGATTCCAAAGAAAATACTATTTGATTCTCATGCCATTGC
TATGCTTCATCATCCCAACAATCATTCCTGTCTTCTGGTGGGGCGAAACATGGAAA

>g3031.t22 Gene=g3031 Length=175
MAPREVVKTSEISVSGVLDENDIETIDGGLKQPSQGYARRRNLKLVWRNIILFAYLHLAA
VYGLWLMLTSAKWTTGIFAMMLYSMSGLGITAGAHRLWAHRAYKAKWPLRIILTIFNTIA
FQDCAIHWARDHRVHHKYRLKLTLIHIMQHAVSSSLISAGSCVVNILMLLLPARN

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g3031.t22 PANTHER PTHR11351 ACYL-COA DESATURASE 13 139 3.3E-58
2 g3031.t22 PANTHER PTHR11351:SF91 DESATURASE 1, ISOFORM A-RELATED 13 139 3.3E-58
4 g3031.t22 PRINTS PR00075 Fatty acid desaturase family 1 signature 47 67 1.0E-27
3 g3031.t22 PRINTS PR00075 Fatty acid desaturase family 1 signature 72 94 1.0E-27
5 g3031.t22 PRINTS PR00075 Fatty acid desaturase family 1 signature 95 115 1.0E-27
9 g3031.t22 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 44 -
17 g3031.t22 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 45 65 -
13 g3031.t22 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 66 76 -
15 g3031.t22 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 77 99 -
10 g3031.t22 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 100 110 -
16 g3031.t22 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 111 130 -
12 g3031.t22 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 131 149 -
14 g3031.t22 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 150 171 -
11 g3031.t22 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 172 175 -
8 g3031.t22 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 45 67 -
7 g3031.t22 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 77 99 -
6 g3031.t22 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 151 173 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed