| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3031 | g3031.t24 | isoform | g3031.t24 | 22217198 | 22218251 |
| chr_3 | g3031 | g3031.t24 | exon | g3031.t24.exon1 | 22217198 | 22217379 |
| chr_3 | g3031 | g3031.t24 | cds | g3031.t24.CDS1 | 22217201 | 22217379 |
| chr_3 | g3031 | g3031.t24 | exon | g3031.t24.exon2 | 22217443 | 22217784 |
| chr_3 | g3031 | g3031.t24 | cds | g3031.t24.CDS2 | 22217443 | 22217784 |
| chr_3 | g3031 | g3031.t24 | exon | g3031.t24.exon3 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t24 | cds | g3031.t24.CDS3 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t24 | exon | g3031.t24.exon4 | 22217988 | 22218251 |
| chr_3 | g3031 | g3031.t24 | cds | g3031.t24.CDS4 | 22217988 | 22218251 |
| chr_3 | g3031 | g3031.t24 | TTS | g3031.t24 | 22218909 | 22218909 |
| chr_3 | g3031 | g3031.t24 | TSS | g3031.t24 | NA | NA |
>g3031.t24 Gene=g3031 Length=861
GCAATGATGTTGTATTCTATGAGCGGTCTTGGAATCACAGCTGGTGCTCATCGTCTATGG
GCTCATCGTGCATACAAAGCTAAATGGCCATTACGCATTATTCTTACTATTTTCAATACA
ATTGCTTTCCAAGATTGCGCAATCCATTGGGCACGCGATCATCGAGTACATCATAAATAC
AGTGAAACTGACGCTGATCCACATAATGCAACACGCGGTTTCTTCTTCTCTCATATCGGC
TGGCTCTTGTGTCGTAAACATCCTGATGTTATTGCTGCCGGCAAGAAATTAGATATTTCC
GATCTTGAGAATGATCCAATTTTACGATTCCAAAGAAAATACTATTTGATTCTCATGCCA
TTGCTATGCTTCATCATCCCAACAATCATTCCTGTCTTCTGGTGGGGCGAAACATGGAAA
AATGCATGGTTTGTTGCAACAATGTTCCGTTACACATTTATTCTCAATGTAACCTGGTTG
GTTAACAGTGCAGCTCACAAATATGGTGATAAACCCTATGACAAATATATCAGTCCATCA
GAGAATATGTCAGTTGCTATCTTTGCTCTTGGTGAGGGATTCCACAATTACCACCATGTT
TTCCCCTGGGATTACAAAACAGCTGAACTCGGCAACTACAGAATGAATTTCACTACAGCA
TTTATTGATTTCTTTGCTAAGATTGGCTGGGCTTATGATTTGAAGACCGTGTCAAATGAA
ATTATTCAAAAACGTGTTGAAAGAACGGGAGATGGCACTCATAAGTCATCCAGAGATTCG
ACTTTATGGGGATATGGTGATCCAGCACAAAATGAAGAAGAAAAGAATATGATACCAATT
TTACACAAAAAAGAAGACTAA
>g3031.t24 Gene=g3031 Length=285
MMLYSMSGLGITAGAHRLWAHRAYKAKWPLRIILTIFNTIAFQDCAIHWARDHRVHHKYS
ETDADPHNATRGFFFSHIGWLLCRKHPDVIAAGKKLDISDLENDPILRFQRKYYLILMPL
LCFIIPTIIPVFWWGETWKNAWFVATMFRYTFILNVTWLVNSAAHKYGDKPYDKYISPSE
NMSVAIFALGEGFHNYHHVFPWDYKTAELGNYRMNFTTAFIDFFAKIGWAYDLKTVSNEI
IQKRVERTGDGTHKSSRDSTLWGYGDPAQNEEEKNMIPILHKKED
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 20 | g3031.t24 | CDD | cd03505 | Delta9-FADS-like | 3 | 234 | 1.95494E-72 |
| 25 | g3031.t24 | MobiDBLite | mobidb-lite | consensus disorder prediction | 248 | 267 | - |
| 2 | g3031.t24 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 2 | 285 | 3.5E-158 |
| 3 | g3031.t24 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 2 | 285 | 3.5E-158 |
| 5 | g3031.t24 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 16 | 36 | 7.6E-53 |
| 7 | g3031.t24 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 53 | 82 | 7.6E-53 |
| 8 | g3031.t24 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 114 | 132 | 7.6E-53 |
| 6 | g3031.t24 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 147 | 168 | 7.6E-53 |
| 4 | g3031.t24 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 190 | 204 | 7.6E-53 |
| 1 | g3031.t24 | Pfam | PF00487 | Fatty acid desaturase | 4 | 201 | 6.8E-16 |
| 13 | g3031.t24 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 20 | - |
| 14 | g3031.t24 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 6 | - |
| 15 | g3031.t24 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 7 | 15 | - |
| 19 | g3031.t24 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 20 | - |
| 12 | g3031.t24 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 21 | 29 | - |
| 17 | g3031.t24 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 50 | - |
| 10 | g3031.t24 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 51 | 112 | - |
| 18 | g3031.t24 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 135 | - |
| 11 | g3031.t24 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 136 | 140 | - |
| 16 | g3031.t24 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 141 | 160 | - |
| 9 | g3031.t24 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 161 | 285 | - |
| 24 | g3031.t24 | ProSitePatterns | PS00476 | Fatty acid desaturases family 1 signature. | 190 | 204 | - |
| 22 | g3031.t24 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 28 | 50 | - |
| 21 | g3031.t24 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 135 | - |
| 23 | g3031.t24 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 140 | 162 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.