Gene loci information

Transcript annotation

  • This transcript has been annotated as Acyl-CoA Delta(11) desaturase.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g3031 g3031.t24 isoform g3031.t24 22217198 22218251
chr_3 g3031 g3031.t24 exon g3031.t24.exon1 22217198 22217379
chr_3 g3031 g3031.t24 cds g3031.t24.CDS1 22217201 22217379
chr_3 g3031 g3031.t24 exon g3031.t24.exon2 22217443 22217784
chr_3 g3031 g3031.t24 cds g3031.t24.CDS2 22217443 22217784
chr_3 g3031 g3031.t24 exon g3031.t24.exon3 22217853 22217925
chr_3 g3031 g3031.t24 cds g3031.t24.CDS3 22217853 22217925
chr_3 g3031 g3031.t24 exon g3031.t24.exon4 22217988 22218251
chr_3 g3031 g3031.t24 cds g3031.t24.CDS4 22217988 22218251
chr_3 g3031 g3031.t24 TTS g3031.t24 22218909 22218909
chr_3 g3031 g3031.t24 TSS g3031.t24 NA NA

Sequences

>g3031.t24 Gene=g3031 Length=861
GCAATGATGTTGTATTCTATGAGCGGTCTTGGAATCACAGCTGGTGCTCATCGTCTATGG
GCTCATCGTGCATACAAAGCTAAATGGCCATTACGCATTATTCTTACTATTTTCAATACA
ATTGCTTTCCAAGATTGCGCAATCCATTGGGCACGCGATCATCGAGTACATCATAAATAC
AGTGAAACTGACGCTGATCCACATAATGCAACACGCGGTTTCTTCTTCTCTCATATCGGC
TGGCTCTTGTGTCGTAAACATCCTGATGTTATTGCTGCCGGCAAGAAATTAGATATTTCC
GATCTTGAGAATGATCCAATTTTACGATTCCAAAGAAAATACTATTTGATTCTCATGCCA
TTGCTATGCTTCATCATCCCAACAATCATTCCTGTCTTCTGGTGGGGCGAAACATGGAAA
AATGCATGGTTTGTTGCAACAATGTTCCGTTACACATTTATTCTCAATGTAACCTGGTTG
GTTAACAGTGCAGCTCACAAATATGGTGATAAACCCTATGACAAATATATCAGTCCATCA
GAGAATATGTCAGTTGCTATCTTTGCTCTTGGTGAGGGATTCCACAATTACCACCATGTT
TTCCCCTGGGATTACAAAACAGCTGAACTCGGCAACTACAGAATGAATTTCACTACAGCA
TTTATTGATTTCTTTGCTAAGATTGGCTGGGCTTATGATTTGAAGACCGTGTCAAATGAA
ATTATTCAAAAACGTGTTGAAAGAACGGGAGATGGCACTCATAAGTCATCCAGAGATTCG
ACTTTATGGGGATATGGTGATCCAGCACAAAATGAAGAAGAAAAGAATATGATACCAATT
TTACACAAAAAAGAAGACTAA

>g3031.t24 Gene=g3031 Length=285
MMLYSMSGLGITAGAHRLWAHRAYKAKWPLRIILTIFNTIAFQDCAIHWARDHRVHHKYS
ETDADPHNATRGFFFSHIGWLLCRKHPDVIAAGKKLDISDLENDPILRFQRKYYLILMPL
LCFIIPTIIPVFWWGETWKNAWFVATMFRYTFILNVTWLVNSAAHKYGDKPYDKYISPSE
NMSVAIFALGEGFHNYHHVFPWDYKTAELGNYRMNFTTAFIDFFAKIGWAYDLKTVSNEI
IQKRVERTGDGTHKSSRDSTLWGYGDPAQNEEEKNMIPILHKKED

Protein features from InterProScan

Transcript Database ID Name Start End E.value
20 g3031.t24 CDD cd03505 Delta9-FADS-like 3 234 1.95494E-72
25 g3031.t24 MobiDBLite mobidb-lite consensus disorder prediction 248 267 -
2 g3031.t24 PANTHER PTHR11351 ACYL-COA DESATURASE 2 285 3.5E-158
3 g3031.t24 PANTHER PTHR11351:SF91 DESATURASE 1, ISOFORM A-RELATED 2 285 3.5E-158
5 g3031.t24 PRINTS PR00075 Fatty acid desaturase family 1 signature 16 36 7.6E-53
7 g3031.t24 PRINTS PR00075 Fatty acid desaturase family 1 signature 53 82 7.6E-53
8 g3031.t24 PRINTS PR00075 Fatty acid desaturase family 1 signature 114 132 7.6E-53
6 g3031.t24 PRINTS PR00075 Fatty acid desaturase family 1 signature 147 168 7.6E-53
4 g3031.t24 PRINTS PR00075 Fatty acid desaturase family 1 signature 190 204 7.6E-53
1 g3031.t24 Pfam PF00487 Fatty acid desaturase 4 201 6.8E-16
13 g3031.t24 Phobius SIGNAL_PEPTIDE Signal peptide region 1 20 -
14 g3031.t24 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 6 -
15 g3031.t24 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 7 15 -
19 g3031.t24 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 16 20 -
12 g3031.t24 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 21 29 -
17 g3031.t24 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 30 50 -
10 g3031.t24 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 51 112 -
18 g3031.t24 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 113 135 -
11 g3031.t24 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 136 140 -
16 g3031.t24 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 141 160 -
9 g3031.t24 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 161 285 -
24 g3031.t24 ProSitePatterns PS00476 Fatty acid desaturases family 1 signature. 190 204 -
22 g3031.t24 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 28 50 -
21 g3031.t24 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 113 135 -
23 g3031.t24 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 140 162 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF
GO:0006629 lipid metabolic process BP

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values