General information for g3031.t26
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g3031 is located on chr_3: 22218013..22218920 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3031 | g3031.t26 | isoform | g3031.t26 | 22217775 | 22218251 |
| chr_3 | g3031 | g3031.t26 | exon | g3031.t26.exon1 | 22217775 | 22217784 |
| chr_3 | g3031 | g3031.t26 | cds | g3031.t26.CDS1 | 22217778 | 22217784 |
| chr_3 | g3031 | g3031.t26 | exon | g3031.t26.exon2 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t26 | cds | g3031.t26.CDS2 | 22217853 | 22217925 |
| chr_3 | g3031 | g3031.t26 | exon | g3031.t26.exon3 | 22217993 | 22218251 |
| chr_3 | g3031 | g3031.t26 | cds | g3031.t26.CDS3 | 22217993 | 22218251 |
| chr_3 | g3031 | g3031.t26 | TTS | g3031.t26 | 22218909 | 22218909 |
| chr_3 | g3031 | g3031.t26 | TSS | g3031.t26 | NA | NA |
Sequences
>g3031.t26 Gene=g3031 Length=342
CCTATGACAAATATATCAGTCCATCAGAGAATATGTCAGTTGCTATCTTTGCTCTTGGTG
AGGGATTCCACAATTACCACCATCCCCTGGGATTACAAAACAGCTGAACTCGGCAACTAC
AGAATGAATTTCACTACAGCATTTATTGATTTCTTTGCTAAGATTGGCTGGGCTTATGAT
TTGAAGACCGTGTCAAATGAAATTATTCAAAAACGTGTTGAAAGAACGGGAGATGGCACT
CATAAGTCATCCAGAGATTCGACTTTATGGGGATATGGTGATCCAGCACAAAATGAAGAA
GAAAAGAATATGATACCAATTTTACACAAAAAAGAAGACTAA
>g3031.t26 Gene=g3031 Length=112
MTNISVHQRICQLLSLLLVRDSTITTIPWDYKTAELGNYRMNFTTAFIDFFAKIGWAYDL
KTVSNEIIQKRVERTGDGTHKSSRDSTLWGYGDPAQNEEEKNMIPILHKKED
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g3031.t26 | MobiDBLite | mobidb-lite | consensus disorder prediction | 75 | 94 | - |
| 1 | g3031.t26 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 26 | 112 | 3.0E-29 |
| 2 | g3031.t26 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 26 | 112 | 3.0E-29 |
| 4 | g3031.t26 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 25 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
