General information for g3083.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Alkaline phosphatase 4.
Parent gene
- The parent gene g3083 is located on chr_3: 22607650..22608125 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3083 | g3083.t9 | isoform | g3083.t9 | 22607650 | 22608125 |
| chr_3 | g3083 | g3083.t9 | exon | g3083.t9.exon1 | 22607650 | 22607788 |
| chr_3 | g3083 | g3083.t9 | cds | g3083.t9.CDS1 | 22607671 | 22607788 |
| chr_3 | g3083 | g3083.t9 | exon | g3083.t9.exon2 | 22607851 | 22607932 |
| chr_3 | g3083 | g3083.t9 | cds | g3083.t9.CDS2 | 22607851 | 22607932 |
| chr_3 | g3083 | g3083.t9 | exon | g3083.t9.exon3 | 22607987 | 22608125 |
| chr_3 | g3083 | g3083.t9 | cds | g3083.t9.CDS3 | 22607987 | 22608125 |
| chr_3 | g3083 | g3083.t9 | TTS | g3083.t9 | 22608245 | 22608245 |
| chr_3 | g3083 | g3083.t9 | TSS | g3083.t9 | NA | NA |
Sequences
>g3083.t9 Gene=g3083 Length=360
ACTGATCCGACAATCAGTCATATGATACCACTTGAAGAGTATACAGAAGAGCAAAGAGGT
GATGCTCTATACATGCATCAGTCTATGATACCAATGTATGACTCTGTTCATGGTGGTGAA
GATGTTGGAGTGTTTTCAGATGGACCAGGATCATTTTTACTACAGAGAACTTTTGAACAA
TGTTATATTGCTTATGCGATATCTTTTGCAAGTTGTATTGGTCCTGCTGCTGACATGAAT
GAATTATGCAAGTCTAAACCAGAAAGGTTGACAAGTGATTCATCAAGTTTAAAAACATCA
ATAGGCCTAACGTTTTTATCAGTTTTATTCTGTAGTTTTAAATTCATTGCATCATTTTGA
>g3083.t9 Gene=g3083 Length=112
MIPLEEYTEEQRGDALYMHQSMIPMYDSVHGGEDVGVFSDGPGSFLLQRTFEQCYIAYAI
SFASCIGPAADMNELCKSKPERLTSDSSSLKTSIGLTFLSVLFCSFKFIASF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g3083.t9 | Gene3D | G3DSA:3.40.720.10 | Alkaline Phosphatase | 3 | 82 | 1.1E-16 |
| 2 | g3083.t9 | PANTHER | PTHR11596 | ALKALINE PHOSPHATASE | 9 | 100 | 2.2E-19 |
| 3 | g3083.t9 | PANTHER | PTHR11596:SF83 | ALKALINE PHOSPHATASE 4 | 9 | 100 | 2.2E-19 |
| 1 | g3083.t9 | Pfam | PF00245 | Alkaline phosphatase | 9 | 66 | 8.4E-6 |
| 7 | g3083.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 53 | - |
| 10 | g3083.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 70 | - |
| 8 | g3083.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 71 | 89 | - |
| 9 | g3083.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 90 | 110 | - |
| 6 | g3083.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 111 | 112 | - |
| 4 | g3083.t9 | SUPERFAMILY | SSF53649 | Alkaline phosphatase-like | 10 | 72 | 1.35E-9 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003824 | catalytic activity | MF |
| GO:0016791 | phosphatase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
