| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g323 | g323.t1 | TSS | g323.t1 | 2713386 | 2713386 |
| chr_3 | g323 | g323.t1 | isoform | g323.t1 | 2713894 | 2732087 |
| chr_3 | g323 | g323.t1 | exon | g323.t1.exon1 | 2713894 | 2714043 |
| chr_3 | g323 | g323.t1 | cds | g323.t1.CDS1 | 2713894 | 2714043 |
| chr_3 | g323 | g323.t1 | exon | g323.t1.exon2 | 2730425 | 2730482 |
| chr_3 | g323 | g323.t1 | cds | g323.t1.CDS2 | 2730425 | 2730482 |
| chr_3 | g323 | g323.t1 | exon | g323.t1.exon3 | 2731960 | 2732087 |
| chr_3 | g323 | g323.t1 | cds | g323.t1.CDS3 | 2731960 | 2732087 |
| chr_3 | g323 | g323.t1 | TTS | g323.t1 | NA | NA |
>g323.t1 Gene=g323 Length=336
ATGATCGTTTCAACAAATGGCCTACAATGTTATCAGTGTGGTCAATTCAATGACGGTGTT
GGTTCCATCACACCATGTCTCAACTATACTGAGACTAATGCTCATTTCTATCTCAAGGAT
TGTCCAAGACGAAGTGATAAATTTTGTGTGAAATATGTCTCTGAGCTTTCTACAGTAAGA
GATTGTGTGGAATCGTGTGTAGAAAAAGAGGTTTGGGACACAAGCACATACTGTTGCAAT
CAAGATGGCTGCAATGATTCAACAATCGCCACAATCTCTAGATTTCTTCTTATTCTAGCG
ACTTTTATTTCACTTTGTTATTTTAATTTTGTATAA
>g323.t1 Gene=g323 Length=111
MIVSTNGLQCYQCGQFNDGVGSITPCLNYTETNAHFYLKDCPRRSDKFCVKYVSELSTVR
DCVESCVEKEVWDTSTYCCNQDGCNDSTIATISRFLLILATFISLCYFNFV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g323.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 88 | - |
| 4 | g323.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 89 | 110 | - |
| 2 | g323.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 111 | 111 | - |
| 1 | g323.t1 | SUPERFAMILY | SSF57302 | Snake toxin-like | 26 | 85 | 2.27E-5 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed