| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3322 | g3322.t7 | TTS | g3322.t7 | 24645006 | 24645006 |
| chr_3 | g3322 | g3322.t7 | isoform | g3322.t7 | 24645075 | 24645621 |
| chr_3 | g3322 | g3322.t7 | exon | g3322.t7.exon1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t7 | cds | g3322.t7.CDS1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t7 | exon | g3322.t7.exon2 | 24645213 | 24645383 |
| chr_3 | g3322 | g3322.t7 | cds | g3322.t7.CDS2 | 24645213 | 24645383 |
| chr_3 | g3322 | g3322.t7 | exon | g3322.t7.exon3 | 24645434 | 24645481 |
| chr_3 | g3322 | g3322.t7 | cds | g3322.t7.CDS3 | 24645434 | 24645481 |
| chr_3 | g3322 | g3322.t7 | exon | g3322.t7.exon4 | 24645585 | 24645621 |
| chr_3 | g3322 | g3322.t7 | cds | g3322.t7.CDS4 | 24645585 | 24645621 |
| chr_3 | g3322 | g3322.t7 | TSS | g3322.t7 | 24645701 | 24645701 |
>g3322.t7 Gene=g3322 Length=333
ATGTCTTACGTTATTCGTCGTGGACCTAGAAAAATTACTGCTATCGGTCGCTGGGCATAT
AATTTGTCAGGATTCAATCAATATGAAGGTCTCCATCATGATGATGTTTTGTACGAAACT
GAGGATGTAAAGGAAGCTCTTCGACGTCTGCCACAACAATACGTTGATGAAAGAAATTTT
AGAATTACTCGCGCATTGCATCTTTCAATGACTAAGACTATTTTGCCTAAAGATCAGTGG
ACAAAATACGAAGAAGATTTCAGATATTTAGAGCCATACTTGGAAGAAGTTCAAAGAGAA
CGTGAAGAAAAGGAAGAATGGAATAAGCAGTAA
>g3322.t7 Gene=g3322 Length=110
MSYVIRRGPRKITAIGRWAYNLSGFNQYEGLHHDDVLYETEDVKEALRRLPQQYVDERNF
RITRALHLSMTKTILPKDQWTKYEEDFRYLEPYLEEVQREREEKEEWNKQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3322.t7 | Coils | Coil | Coil | 90 | 110 | - |
| 5 | g3322.t7 | Gene3D | G3DSA:1.10.1090.10 | Cytochrome Bc1 Complex; Chain F | 3 | 110 | 1.1E-42 |
| 2 | g3322.t7 | PANTHER | PTHR12022:SF5 | CYTOCHROME B-C1 COMPLEX SUBUNIT 7 | 12 | 109 | 1.3E-32 |
| 3 | g3322.t7 | PANTHER | PTHR12022 | UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KD PROTEIN | 12 | 109 | 1.3E-32 |
| 7 | g3322.t7 | PIRSF | PIRSF000022 | Bc1_14K | 1 | 110 | 1.4E-45 |
| 1 | g3322.t7 | Pfam | PF02271 | Ubiquinol-cytochrome C reductase complex 14kD subunit | 12 | 105 | 2.3E-34 |
| 4 | g3322.t7 | SUPERFAMILY | SSF81524 | 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) | 13 | 109 | 1.57E-37 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005750 | mitochondrial respiratory chain complex III | CC |
| GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.