| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3322 | g3322.t9 | TTS | g3322.t9 | 24645006 | 24645006 |
| chr_3 | g3322 | g3322.t9 | isoform | g3322.t9 | 24645075 | 24645621 |
| chr_3 | g3322 | g3322.t9 | exon | g3322.t9.exon1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t9 | cds | g3322.t9.CDS1 | 24645075 | 24645151 |
| chr_3 | g3322 | g3322.t9 | exon | g3322.t9.exon2 | 24645213 | 24645380 |
| chr_3 | g3322 | g3322.t9 | cds | g3322.t9.CDS2 | 24645213 | 24645261 |
| chr_3 | g3322 | g3322.t9 | exon | g3322.t9.exon3 | 24645434 | 24645481 |
| chr_3 | g3322 | g3322.t9 | exon | g3322.t9.exon4 | 24645581 | 24645621 |
| chr_3 | g3322 | g3322.t9 | TSS | g3322.t9 | 24645701 | 24645701 |
>g3322.t9 Gene=g3322 Length=334
ATGTCTTACGTTATTCGTCGTGGACCTAGAAAAATTAGTAACTGCTATCGGTCGCTGGGC
ATATAATTTGTCAGGATTCAATCAATATGGTCTCCATCATGATGATGTTTTGTACGAAAC
TGAGGATGTAAAGGAAGCTCTTCGACGTCTGCCACAACAATACGTTGATGAAAGAAATTT
TAGAATTACTCGCGCATTGCATCTTTCAATGACTAAGACTATTTTGCCTAAAGATCAGTG
GACAAAATACGAAGAAGATTTCAGATATTTAGAGCCATACTTGGAAGAAGTTCAAAGAGA
ACGTGAAGAAAAGGAAGAATGGAATAAGCAGTAA
>g3322.t9 Gene=g3322 Length=41
MTKTILPKDQWTKYEEDFRYLEPYLEEVQREREEKEEWNKQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g3322.t9 | Coils | Coil | Coil | 21 | 41 | - |
| 3 | g3322.t9 | Gene3D | G3DSA:1.10.1090.10 | Cytochrome Bc1 Complex; Chain F | 1 | 41 | 1.6E-14 |
| 1 | g3322.t9 | Pfam | PF02271 | Ubiquinol-cytochrome C reductase complex 14kD subunit | 1 | 36 | 4.6E-11 |
| 2 | g3322.t9 | SUPERFAMILY | SSF81524 | 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) | 1 | 40 | 2.62E-15 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005750 | mitochondrial respiratory chain complex III | CC |
| GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.