| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3367 | g3367.t10 | TSS | g3367.t10 | 24884190 | 24884190 |
| chr_3 | g3367 | g3367.t10 | isoform | g3367.t10 | 24884411 | 24884970 |
| chr_3 | g3367 | g3367.t10 | exon | g3367.t10.exon1 | 24884411 | 24884520 |
| chr_3 | g3367 | g3367.t10 | exon | g3367.t10.exon2 | 24884586 | 24884833 |
| chr_3 | g3367 | g3367.t10 | cds | g3367.t10.CDS1 | 24884645 | 24884833 |
| chr_3 | g3367 | g3367.t10 | exon | g3367.t10.exon3 | 24884896 | 24884970 |
| chr_3 | g3367 | g3367.t10 | cds | g3367.t10.CDS2 | 24884896 | 24884970 |
| chr_3 | g3367 | g3367.t10 | TTS | g3367.t10 | 24885195 | 24885195 |
>g3367.t10 Gene=g3367 Length=433
AGAACTAACACTTAATGCACCAGAAGGAATAATTGCAGGACCTATATCAGAAGAAAACTT
TTTCGAATGGGAAGCATTAATAAGCGGGCCATCAGATACAATTTTTGAAGGTGGTTTATT
TCCTGCTAAACTGGTCTTTCCAACTGATTATCCGCTAAATCCTCCGAAAATGAGCTTCTT
ATGCGAAATGTTTCATCCAAATATATTCCCTGATGGACGAGTATGCATTTCAATTTTACA
TAGTCCCGGTGATGATCCACTCGGTTATGAGTCGTCATCTGAGAGATGGAGTCCTGTTCA
ATCTGTAGAAAAAATTCTATTATCTGTGGTTTCAATGCTTGCTGAACCTAATAATGAGTC
TCCAGCAAACGTAGATGCTAGTAAAATGTGGCGAGAAAATAGAGAAGAGTTCAATAGAAT
TGCACAAAGGATA
>g3367.t10 Gene=g3367 Length=88
MSFLCEMFHPNIFPDGRVCISILHSPGDDPLGYESSSERWSPVQSVEKILLSVVSMLAEP
NNESPANVDASKMWRENREEFNRIAQRI
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3367.t10 | CDD | cd00195 | UBCc | 1 | 87 | 9.49729E-32 |
| 5 | g3367.t10 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 88 | 8.9E-37 |
| 2 | g3367.t10 | PANTHER | PTHR24067:SF154 | UBIQUITIN-CONJUGATING ENZYME E2 G2 | 1 | 87 | 2.4E-44 |
| 3 | g3367.t10 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 87 | 2.4E-44 |
| 1 | g3367.t10 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 1 | 87 | 5.2E-25 |
| 7 | g3367.t10 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 8 | 23 | - |
| 9 | g3367.t10 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 83 | 21.731 |
| 8 | g3367.t10 | SMART | SM00212 | ubc_7 | 1 | 88 | 8.3E-4 |
| 4 | g3367.t10 | SUPERFAMILY | SSF54495 | UBC-like | 2 | 87 | 1.39E-28 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.