General information for g3367.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 G2.
Parent gene
- The parent gene g3367 is located on chr_3: 24884411..24888356 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3367 | g3367.t9 | TSS | g3367.t9 | 24884190 | 24884190 |
| chr_3 | g3367 | g3367.t9 | isoform | g3367.t9 | 24884279 | 24884970 |
| chr_3 | g3367 | g3367.t9 | exon | g3367.t9.exon1 | 24884279 | 24884314 |
| chr_3 | g3367 | g3367.t9 | cds | g3367.t9.CDS1 | 24884299 | 24884314 |
| chr_3 | g3367 | g3367.t9 | exon | g3367.t9.exon2 | 24884413 | 24884520 |
| chr_3 | g3367 | g3367.t9 | cds | g3367.t9.CDS2 | 24884413 | 24884520 |
| chr_3 | g3367 | g3367.t9 | exon | g3367.t9.exon3 | 24884586 | 24884833 |
| chr_3 | g3367 | g3367.t9 | cds | g3367.t9.CDS3 | 24884586 | 24884833 |
| chr_3 | g3367 | g3367.t9 | exon | g3367.t9.exon4 | 24884896 | 24884970 |
| chr_3 | g3367 | g3367.t9 | cds | g3367.t9.CDS4 | 24884896 | 24884970 |
| chr_3 | g3367 | g3367.t9 | TTS | g3367.t9 | 24885195 | 24885195 |
Sequences
>g3367.t9 Gene=g3367 Length=467
GACAAGCTTTAAGAAGATTAATGGCAGAATATAAACAACTAACACTTAATGCACCAGAAG
GAATAATTGCAGGACCTATATCAGAAGAAAACTTTTTCGAATGGGAAGCATTAATAAGCG
GGCCATCAGATACAATTTTTGAAGGTGGTTTATTTCCTGCTAAACTGGTCTTTCCAACTG
ATTATCCGCTAAATCCTCCGAAAATGAGCTTCTTATGCGAAATGTTTCATCCAAATATAT
TCCCTGATGGACGAGTATGCATTTCAATTTTACATAGTCCCGGTGATGATCCACTCGGTT
ATGAGTCGTCATCTGAGAGATGGAGTCCTGTTCAATCTGTAGAAAAAATTCTATTATCTG
TGGTTTCAATGCTTGCTGAACCTAATAATGAGTCTCCAGCAAACGTAGATGCTAGTAAAA
TGTGGCGAGAAAATAGAGAAGAGTTCAATAGAATTGCACAAAGGATA
>g3367.t9 Gene=g3367 Length=149
MAEYKQLTLNAPEGIIAGPISEENFFEWEALISGPSDTIFEGGLFPAKLVFPTDYPLNPP
KMSFLCEMFHPNIFPDGRVCISILHSPGDDPLGYESSSERWSPVQSVEKILLSVVSMLAE
PNNESPANVDASKMWRENREEFNRIAQRI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3367.t9 | CDD | cd00195 | UBCc | 1 | 148 | 1.46116E-59 |
| 5 | g3367.t9 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 149 | 1.2E-66 |
| 2 | g3367.t9 | PANTHER | PTHR24067:SF154 | UBIQUITIN-CONJUGATING ENZYME E2 G2 | 1 | 148 | 1.1E-80 |
| 3 | g3367.t9 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 148 | 1.1E-80 |
| 1 | g3367.t9 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 2 | 147 | 1.1E-47 |
| 7 | g3367.t9 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 69 | 84 | - |
| 9 | g3367.t9 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 144 | 39.638 |
| 8 | g3367.t9 | SMART | SM00212 | ubc_7 | 1 | 149 | 3.5E-56 |
| 4 | g3367.t9 | SUPERFAMILY | SSF54495 | UBC-like | 1 | 148 | 1.69E-53 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K04555 (ubiquitin-conjugating enzyme E2 G2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
