Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g3425 g3425.t18 TTS g3425.t18 25307620 25307620
chr_3 g3425 g3425.t18 isoform g3425.t18 25308441 25308886
chr_3 g3425 g3425.t18 exon g3425.t18.exon1 25308441 25308504
chr_3 g3425 g3425.t18 cds g3425.t18.CDS1 25308441 25308504
chr_3 g3425 g3425.t18 exon g3425.t18.exon2 25308573 25308775
chr_3 g3425 g3425.t18 cds g3425.t18.CDS2 25308573 25308775
chr_3 g3425 g3425.t18 exon g3425.t18.exon3 25308830 25308886
chr_3 g3425 g3425.t18 cds g3425.t18.CDS3 25308830 25308886
chr_3 g3425 g3425.t18 TSS g3425.t18 25308935 25308935

Sequences

>g3425.t18 Gene=g3425 Length=324
ATGGAAAAGTTTTTACTTTTATTAACAATTATTTTATTTTTTGCTGTTATCTTAGAAGCT
GGTGTAACACATGTGCTACCTAATCAATTGCCATTATTCGAAAGAAAAGTGCAAGGAAGA
ATTGTCGGTGGTTCGCGACCAAGTACAACTCAATTTCCCTATACAGTGTCAGTTCGCGCA
TTTAATGGAACATCAACCTCGTTTTGCGGTGGTTCTATAATTTCTTACAATTTTGTTCTG
ACTGCTGCACATTGCACTCGTGGCTATCAAGATTTCGAAATTGGTGTAGGCTCAATAGTT
CTTCAAACTCCATTTTTTAAAATA

>g3425.t18 Gene=g3425 Length=108
MEKFLLLLTIILFFAVILEAGVTHVLPNQLPLFERKVQGRIVGGSRPSTTQFPYTVSVRA
FNGTSTSFCGGSIISYNFVLTAAHCTRGYQDFEIGVGSIVLQTPFFKI

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g3425.t18 Gene3D G3DSA:2.40.10.10 - 33 104 6.2E-16
2 g3425.t18 PANTHER PTHR24260 - 35 101 1.4E-13
3 g3425.t18 PANTHER PTHR24260:SF90 AT07769P-RELATED 35 101 1.4E-13
1 g3425.t18 Pfam PF00089 Trypsin 41 98 6.8E-13
8 g3425.t18 Phobius SIGNAL_PEPTIDE Signal peptide region 1 20 -
9 g3425.t18 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 3 -
10 g3425.t18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 4 15 -
11 g3425.t18 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 16 20 -
7 g3425.t18 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 21 108 -
14 g3425.t18 ProSitePatterns PS00134 Serine proteases, trypsin family, histidine active site. 80 85 -
4 g3425.t18 SUPERFAMILY SSF50494 Trypsin-like serine proteases 4 103 4.42E-21
5 g3425.t18 SignalP_EUK SignalP-noTM SignalP-noTM 1 20 -
13 g3425.t18 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 5 27 -
12 g3425.t18 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 58 80 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004252 serine-type endopeptidase activity MF
GO:0006508 proteolysis BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed