| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3472 | g3472.t15 | TSS | g3472.t15 | 25772089 | 25772089 |
| chr_3 | g3472 | g3472.t15 | isoform | g3472.t15 | 25772160 | 25773395 |
| chr_3 | g3472 | g3472.t15 | exon | g3472.t15.exon1 | 25772160 | 25772187 |
| chr_3 | g3472 | g3472.t15 | exon | g3472.t15.exon2 | 25772417 | 25772751 |
| chr_3 | g3472 | g3472.t15 | exon | g3472.t15.exon3 | 25772800 | 25773016 |
| chr_3 | g3472 | g3472.t15 | cds | g3472.t15.CDS1 | 25772882 | 25773016 |
| chr_3 | g3472 | g3472.t15 | exon | g3472.t15.exon4 | 25773075 | 25773395 |
| chr_3 | g3472 | g3472.t15 | cds | g3472.t15.CDS2 | 25773075 | 25773395 |
| chr_3 | g3472 | g3472.t15 | TTS | g3472.t15 | 25773546 | 25773546 |
>g3472.t15 Gene=g3472 Length=901
ATGGAGGTAAACTTGTTAATCAAATACTTTATAACAAAATGTAATGTTCAATCCAGCACA
ACGATAAAAGATTTGAAATCCAGTGTATATGCGGCAAATAAAAAATTAAATGTTCATCGT
CAATCATTTAAGCTGGAAGTAAAAGGAAAAACACTTAAGGATAGTGACACAATTGAATCA
TTGAACTTAAGAAATGGTAGTAAATTGTATGTTAAAGATCTTGGTCCGCAAATTGGTTGG
TCAACTGTTTTCCTTTGCGAATATGCTGGTCCACTTGTTGTTTATTTATGGGTTTATACT
CGTCCTTGGTTGTTTTATGGTGACACATCGTCATCAGCTGAAATCAGTCAAACAGCACAG
TAATATTGCTGCTGCATGCTACACATTGCATTATGCTAAACGATTACTTGAAACAATTTT
CGTTCATCGCTTTTCACATGCGACAATGCCTATGAGAAATTTGTTCAAAAACTGCATCTA
CTATTGGGGATTTACTGCTTACGTTGCCTATCACGTTAATCATCCTCTTTTTACATCACC
ATCTACTGCTCAAGTTTATGCTAGTCTTGCCGCATTCTTGTTATGTGAACTTGGTAACTT
TTCAATACATATCAATTTGAGAAATTTAAGACCACCAGGAACATCTGTAAGAAAAATTCC
AATGTCTGATTCAAATCCGCTAACTGCTCTCTTTAACTTCGTTTCGTGTCCAAATTATAC
TTACGAGTTCGGAGCTTGGCTTTCATTTTCTATCATGACTCAATGCTTGCCTGCTTTCCT
TTTTGCTGCTGCTGGAATGTATCAAATGACAATGTGGGCTATCGGAAAACATAAGAACTA
CAAAAAAGAATTCAAAGAATATCCAAAGCAAAGAAAAGCTATTATTCCATTTTTATTGTA
A
>g3472.t15 Gene=g3472 Length=151
MPMRNLFKNCIYYWGFTAYVAYHVNHPLFTSPSTAQVYASLAAFLLCELGNFSIHINLRN
LRPPGTSVRKIPMSDSNPLTALFNFVSCPNYTYEFGAWLSFSIMTQCLPAFLFAAAGMYQ
MTMWAIGKHKNYKKEFKEYPKQRKAIIPFLL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g3472.t15 | PANTHER | PTHR10556:SF31 | VERY-LONG-CHAIN ENOYL-COA REDUCTASE | 1 | 151 | 1.2E-61 |
| 3 | g3472.t15 | PANTHER | PTHR10556 | 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE | 1 | 151 | 1.2E-61 |
| 1 | g3472.t15 | Pfam | PF02544 | 3-oxo-5-alpha-steroid 4-dehydrogenase | 1 | 151 | 2.3E-30 |
| 7 | g3472.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 12 | g3472.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 29 | - |
| 11 | g3472.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 30 | 34 | - |
| 13 | g3472.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 58 | - |
| 9 | g3472.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 59 | 78 | - |
| 14 | g3472.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 104 | - |
| 10 | g3472.t15 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 105 | 109 | - |
| 15 | g3472.t15 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 110 | 127 | - |
| 8 | g3472.t15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 128 | 151 | - |
| 6 | g3472.t15 | ProSiteProfiles | PS50244 | Steroid 5-alpha reductase C-terminal domain profile. | 40 | 126 | 22.185 |
| 5 | g3472.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 29 | - |
| 4 | g3472.t15 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 117 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | MF |
| GO:0006629 | lipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed