| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3472 | g3472.t2 | TSS | g3472.t2 | 25772089 | 25772089 |
| chr_3 | g3472 | g3472.t2 | isoform | g3472.t2 | 25772160 | 25772819 |
| chr_3 | g3472 | g3472.t2 | exon | g3472.t2.exon1 | 25772160 | 25772165 |
| chr_3 | g3472 | g3472.t2 | cds | g3472.t2.CDS1 | 25772160 | 25772165 |
| chr_3 | g3472 | g3472.t2 | exon | g3472.t2.exon2 | 25772226 | 25772256 |
| chr_3 | g3472 | g3472.t2 | cds | g3472.t2.CDS2 | 25772226 | 25772256 |
| chr_3 | g3472 | g3472.t2 | exon | g3472.t2.exon3 | 25772417 | 25772751 |
| chr_3 | g3472 | g3472.t2 | cds | g3472.t2.CDS3 | 25772417 | 25772751 |
| chr_3 | g3472 | g3472.t2 | exon | g3472.t2.exon4 | 25772800 | 25772819 |
| chr_3 | g3472 | g3472.t2 | TTS | g3472.t2 | 25773546 | 25773546 |
>g3472.t2 Gene=g3472 Length=392
ATGGAGATTGAAATTCTTGATGCACGAAATTCAAAAGTTATAACAAAATGTAATGTTCAA
TCCAGCACAACGATAAAAGATTTGAAATCCAGTGTATATGCGGCAAATAAAAAATTAAAT
GTTCATCGTCAATCATTTAAGCTGGAAGTAAAAGGAAAAACACTTAAGGATAGTGACACA
ATTGAATCATTGAACTTAAGAAATGGTAGTAAATTGTATGTTAAAGATCTTGGTCCGCAA
ATTGGTTGGTCAACTGTTTTCCTTTGCGAATATGCTGGTCCACTTGTTGTTTATTTATGG
GTTTATACTCGTCCTTGGTTGTTTTATGGTGACACATCGTCATCAGCTGAAATCAGTCAA
ACAGCACAGTAATATTGCTGCTGCATGCTACA
>g3472.t2 Gene=g3472 Length=123
MEIEILDARNSKVITKCNVQSSTTIKDLKSSVYAANKKLNVHRQSFKLEVKGKTLKDSDT
IESLNLRNGSKLYVKDLGPQIGWSTVFLCEYAGPLVVYLWVYTRPWLFYGDTSSSAEISQ
TAQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3472.t2 | CDD | cd01801 | Ubl_TECR_like | 2 | 77 | 1.79398E-22 |
| 5 | g3472.t2 | Gene3D | G3DSA:3.10.20.90 | - | 1 | 77 | 3.6E-23 |
| 2 | g3472.t2 | PANTHER | PTHR10556:SF28 | SC2 | 1 | 120 | 1.7E-23 |
| 3 | g3472.t2 | PANTHER | PTHR10556 | 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE | 1 | 120 | 1.7E-23 |
| 1 | g3472.t2 | Pfam | PF00240 | Ubiquitin family | 16 | 74 | 3.2E-8 |
| 9 | g3472.t2 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 1 | 74 | 11.442 |
| 8 | g3472.t2 | SMART | SM00213 | ubq_7 | 3 | 77 | 4.9E-4 |
| 4 | g3472.t2 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 12 | 74 | 1.37E-9 |
| 7 | g3472.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 103 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed