General information for g3472.t22
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Probable very-long-chain enoyl-CoA reductase art-1.
Parent gene
- The parent gene g3472 is located on chr_3: 25772874..25773395 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3472 | g3472.t22 | TSS | g3472.t22 | 25772089 | 25772089 |
| chr_3 | g3472 | g3472.t22 | isoform | g3472.t22 | 25772415 | 25773395 |
| chr_3 | g3472 | g3472.t22 | exon | g3472.t22.exon1 | 25772415 | 25772747 |
| chr_3 | g3472 | g3472.t22 | exon | g3472.t22.exon2 | 25772800 | 25773016 |
| chr_3 | g3472 | g3472.t22 | cds | g3472.t22.CDS1 | 25772882 | 25773016 |
| chr_3 | g3472 | g3472.t22 | exon | g3472.t22.exon3 | 25773075 | 25773199 |
| chr_3 | g3472 | g3472.t22 | cds | g3472.t22.CDS2 | 25773075 | 25773199 |
| chr_3 | g3472 | g3472.t22 | exon | g3472.t22.exon4 | 25773278 | 25773395 |
| chr_3 | g3472 | g3472.t22 | cds | g3472.t22.CDS3 | 25773278 | 25773395 |
| chr_3 | g3472 | g3472.t22 | TTS | g3472.t22 | 25773546 | 25773546 |
Sequences
>g3472.t22 Gene=g3472 Length=793
AGTTATAACAAAATGTAATGTTCAATCCAGCACAACGATAAAAGATTTGAAATCCAGTGT
ATATGCGGCAAATAAAAAATTAAATGTTCATCGTCAATCATTTAAGCTGGAAGTAAAAGG
AAAAACACTTAAGGATAGTGACACAATTGAATCATTGAACTTAAGAAATGGTAGTAAATT
GTATGTTAAAGATCTTGGTCCGCAAATTGGTTGGTCAACTGTTTTCCTTTGCGAATATGC
TGGTCCACTTGTTGTTTATTTATGGGTTTATACTCGTCCTTGGTTGTTTTATGGTGACAC
ATCGTCATCAGCTGAAATCAGTCAAACAGCACATATTGCTGCTGCATGCTACACATTGCA
TTATGCTAAACGATTACTTGAAACAATTTTCGTTCATCGCTTTTCACATGCGACAATGCC
TATGAGAAATTTGTTCAAAAACTGCATCTACTATTGGGGATTTACTGCTTACGTTGCCTA
TCACGTTAATCATCCTCTTTTTACATCACCATCTACTGCTCAAGTTTATGCTAGTCTTGC
CGCATTCTTGTTATGTGAACTTGGTAACTTTTCAATACATATCAATTTGAGAAATTTAAG
ACCACCAGGAACATCTGTAAGAAAAATTCCAATGTCTGATTCAAATCCGCTAACTGCTCT
CTTTAACTTCGTTTCTGCTGCTGCTGGAATGTATCAAATGACAATGTGGGCTATCGGAAA
ACATAAGAACTACAAAAAAGAATTCAAAGAATATCCAAAGCAAAGAAAAGCTATTATTCC
ATTTTTATTGTAA
>g3472.t22 Gene=g3472 Length=125
MPMRNLFKNCIYYWGFTAYVAYHVNHPLFTSPSTAQVYASLAAFLLCELGNFSIHINLRN
LRPPGTSVRKIPMSDSNPLTALFNFVSAAAGMYQMTMWAIGKHKNYKKEFKEYPKQRKAI
IPFLL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g3472.t22 | PANTHER | PTHR10556:SF31 | VERY-LONG-CHAIN ENOYL-COA REDUCTASE | 1 | 89 | 5.0E-39 |
| 6 | g3472.t22 | PANTHER | PTHR10556 | 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE | 1 | 89 | 5.0E-39 |
| 3 | g3472.t22 | PANTHER | PTHR10556:SF31 | VERY-LONG-CHAIN ENOYL-COA REDUCTASE | 91 | 125 | 5.0E-39 |
| 5 | g3472.t22 | PANTHER | PTHR10556 | 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE | 91 | 125 | 5.0E-39 |
| 1 | g3472.t22 | Pfam | PF02544 | 3-oxo-5-alpha-steroid 4-dehydrogenase | 1 | 89 | 1.6E-5 |
| 2 | g3472.t22 | Pfam | PF02544 | 3-oxo-5-alpha-steroid 4-dehydrogenase | 90 | 125 | 3.5E-9 |
| 11 | g3472.t22 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 15 | g3472.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 29 | - |
| 13 | g3472.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 30 | 34 | - |
| 16 | g3472.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 58 | - |
| 12 | g3472.t22 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 59 | 78 | - |
| 17 | g3472.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 100 | - |
| 14 | g3472.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 101 | 125 | - |
| 10 | g3472.t22 | ProSiteProfiles | PS50244 | Steroid 5-alpha reductase C-terminal domain profile. | 40 | 98 | 11.491 |
| 8 | g3472.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 26 | - |
| 9 | g3472.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 36 | 58 | - |
| 7 | g3472.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 101 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed