General information for g3679.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein 7.
Parent gene
- The parent gene g3679 is located on chr_3: 27379633..27389070 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3679 | g3679.t10 | TSS | g3679.t10 | 27378040 | 27378040 |
| chr_3 | g3679 | g3679.t10 | isoform | g3679.t10 | 27378198 | 27379247 |
| chr_3 | g3679 | g3679.t10 | exon | g3679.t10.exon1 | 27378198 | 27378261 |
| chr_3 | g3679 | g3679.t10 | cds | g3679.t10.CDS1 | 27378198 | 27378261 |
| chr_3 | g3679 | g3679.t10 | exon | g3679.t10.exon2 | 27378330 | 27378514 |
| chr_3 | g3679 | g3679.t10 | cds | g3679.t10.CDS2 | 27378330 | 27378514 |
| chr_3 | g3679 | g3679.t10 | exon | g3679.t10.exon3 | 27378591 | 27378671 |
| chr_3 | g3679 | g3679.t10 | cds | g3679.t10.CDS3 | 27378591 | 27378671 |
| chr_3 | g3679 | g3679.t10 | exon | g3679.t10.exon4 | 27379013 | 27379247 |
| chr_3 | g3679 | g3679.t10 | cds | g3679.t10.CDS4 | 27379013 | 27379246 |
| chr_3 | g3679 | g3679.t10 | TTS | g3679.t10 | 27380148 | 27380148 |
Sequences
>g3679.t10 Gene=g3679 Length=565
ATGGATAATAGTACAACGAGCGCTATAGCAAAATATTGGGACTATTTGTTTGTTAAGTTG
GCAGATGAGCGAACAAATGAATGGCCATTGATTAAATCACCGTTCCCAGGTCTCACAATT
ATTGCACTTTATCTATACTTCGTAAATGTGGCTGGACCACGATTTATGAAGGATCGTAAA
CCTTTTCAAATGAAGAAAACCTTAATTGTGTATAATTTCCTGCAAGTACTTGTCAGTGTA
TATCTTTTCGGCATGAATGGTGGATGGCTTAGACACTACTCTTGGAGATGTCAACCTGTA
GACACATCCAGAAGTGAATTTGGAATGAGAGAAGCACGCGGCTGCTATGTATATTTCATT
GCCAAACTTACTGAACTCTTGGACACAATTTTCTTTGTACTTCGAAAAAAAGATAATCAG
GTGTCTTTTCTGCATCTGTATCATCACACAGTAATGCCCATGATTTCATGGGGTTGTACT
AAGTATTTCCCTGGCGGCCATGGTACTTTTATCGGCGTAATTAACTCTTTTGTTCATATT
GTTATGTACTTTTACTATATGATGG
>g3679.t10 Gene=g3679 Length=188
MDNSTTSAIAKYWDYLFVKLADERTNEWPLIKSPFPGLTIIALYLYFVNVAGPRFMKDRK
PFQMKKTLIVYNFLQVLVSVYLFGMNGGWLRHYSWRCQPVDTSRSEFGMREARGCYVYFI
AKLTELLDTIFFVLRKKDNQVSFLHLYHHTVMPMISWGCTKYFPGGHGTFIGVINSFVHI
VMYFYYMM
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g3679.t10 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 8 | 188 | 1.4E-93 |
| 3 | g3679.t10 | PANTHER | PTHR11157:SF153 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 8 | 188 | 1.4E-93 |
| 1 | g3679.t10 | Pfam | PF01151 | GNS1/SUR4 family | 30 | 188 | 3.3E-44 |
| 11 | g3679.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 34 | - |
| 13 | g3679.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 56 | - |
| 9 | g3679.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 57 | 67 | - |
| 17 | g3679.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 85 | - |
| 10 | g3679.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 86 | 115 | - |
| 16 | g3679.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 134 | - |
| 7 | g3679.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 135 | 145 | - |
| 15 | g3679.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 146 | 163 | - |
| 12 | g3679.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 164 | 168 | - |
| 14 | g3679.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 169 | 186 | - |
| 8 | g3679.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 187 | 188 | - |
| 6 | g3679.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 56 | - |
| 4 | g3679.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 90 | - |
| 5 | g3679.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 163 | 185 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed