General information for g370.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g370 is located on chr_3: 3052180..3052748 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g370 | g370.t1 | TTS | g370.t1 | 3051938 | 3051938 |
| chr_3 | g370 | g370.t1 | isoform | g370.t1 | 3052180 | 3052748 |
| chr_3 | g370 | g370.t1 | exon | g370.t1.exon1 | 3052180 | 3052326 |
| chr_3 | g370 | g370.t1 | cds | g370.t1.CDS1 | 3052180 | 3052326 |
| chr_3 | g370 | g370.t1 | exon | g370.t1.exon2 | 3052423 | 3052536 |
| chr_3 | g370 | g370.t1 | cds | g370.t1.CDS2 | 3052423 | 3052536 |
| chr_3 | g370 | g370.t1 | exon | g370.t1.exon3 | 3052737 | 3052748 |
| chr_3 | g370 | g370.t1 | cds | g370.t1.CDS3 | 3052737 | 3052748 |
| chr_3 | g370 | g370.t1 | TSS | g370.t1 | 3052804 | 3052804 |
Sequences
>g370.t1 Gene=g370 Length=273
ATGTCATTGAAATCGACACTTCGCGTTGCAGCAAATGCTCGTCAGTTTTCAAGATCATCA
GTCGTTCTTAAGGATGAAATTCATCCCGGTTACTTCAGACTAAAGAAAATCCAGGAACAC
TTTCAGAAAAATGACGGTTTACCAGTTCATTTAAAAGGAGGTCCCTTGGATAAAGTTTTG
TATGGTATCACTGTGGTTGCTTGCATCTATGGTTTGGGACAATTTGGAAAACTTATTTAT
GATCTTGGATTTGCTCCTCCTAAAAAAGATTAA
>g370.t1 Gene=g370 Length=90
MSLKSTLRVAANARQFSRSSVVLKDEIHPGYFRLKKIQEHFQKNDGLPVHLKGGPLDKVL
YGITVVACIYGLGQFGKLIYDLGFAPPKKD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g370.t1 | CDD | cd00928 | Cyt_c_Oxidase_VIIa | 30 | 84 | 2.98465E-20 |
| 4 | g370.t1 | Gene3D | G3DSA:4.10.91.10 | Cytochrome C Oxidase | 32 | 89 | 3.0E-16 |
| 1 | g370.t1 | PANTHER | PTHR10510:SF11 | CYTOCHROME C OXIDASE SUBUNIT 7A, MITOCHONDRIAL | 11 | 84 | 1.4E-16 |
| 2 | g370.t1 | PANTHER | PTHR10510 | CYTOCHROME C OXIDASE POLYPEPTIDE 7A | 11 | 84 | 1.4E-16 |
| 6 | g370.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 58 | - |
| 7 | g370.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 80 | - |
| 5 | g370.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 81 | 90 | - |
| 3 | g370.t1 | SUPERFAMILY | SSF81419 | Mitochondrial cytochrome c oxidase subunit VIIa | 33 | 84 | 1.83E-16 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0009055 | electron transfer activity | MF |
| GO:0004129 | cytochrome-c oxidase activity | MF |
| GO:0005746 | mitochondrial respirasome | CC |
KEGG
Orthology
- This transcript has been annotated with K02270 (cytochrome c oxidase subunit 7a)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
