| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3711 | g3711.t8 | isoform | g3711.t8 | 27581458 | 27583675 |
| chr_3 | g3711 | g3711.t8 | exon | g3711.t8.exon1 | 27581458 | 27581648 |
| chr_3 | g3711 | g3711.t8 | cds | g3711.t8.CDS1 | 27581458 | 27581648 |
| chr_3 | g3711 | g3711.t8 | exon | g3711.t8.exon2 | 27583486 | 27583675 |
| chr_3 | g3711 | g3711.t8 | cds | g3711.t8.CDS2 | 27583486 | 27583675 |
| chr_3 | g3711 | g3711.t8 | TSS | g3711.t8 | 27584122 | 27584122 |
| chr_3 | g3711 | g3711.t8 | TTS | g3711.t8 | NA | NA |
>g3711.t8 Gene=g3711 Length=381
ATGGGACTCTCAACACAGGGAAAGAACATTCACGATGTAATAACTGCACGACATGAGTCC
GAAATTCGTCTCATCGAAGTTATGCGTAAATGTTTATTACTAAAAGTAAAGTGCGATCGT
GATTATGCGTCTTCAATCCAGAGTGTTTCCGTCGTTGGTCTCAAAATTGATCGAATAGAC
GATCTAAATGGAAGTCAAATTTTCAAAACATGGAAGCGATTTATGGAAGAATTAGAAAAT
CAATCTAAGTTGATTCGCAAGAAAATGGAATGTTTAGAGAACATTTGCATCGATCGAATA
TCAAATATTTTAGTTGAAAAAAGAAAAATAAAGAAGCAATGTCAAGACGATCATGAAAAA
ATTGCGTCAAGACTATTCCAG
>g3711.t8 Gene=g3711 Length=127
MGLSTQGKNIHDVITARHESEIRLIEVMRKCLLLKVKCDRDYASSIQSVSVVGLKIDRID
DLNGSQIFKTWKRFMEELENQSKLIRKKMECLENICIDRISNILVEKRKIKKQCQDDHEK
IASRLFQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g3711.t8 | Coils | Coil | Coil | 75 | 95 | - |
| 4 | g3711.t8 | Gene3D | G3DSA:1.20.1270.60 | Arfaptin | 2 | 127 | 2.3E-16 |
| 1 | g3711.t8 | Pfam | PF00611 | Fes/CIP4, and EFC/F-BAR homology domain | 12 | 84 | 1.3E-6 |
| 3 | g3711.t8 | SMART | SM00055 | fch_2 | 1 | 92 | 0.0083 |
| 2 | g3711.t8 | SUPERFAMILY | SSF103657 | BAR/IMD domain-like | 11 | 125 | 8.37E-10 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed