| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3758 | g3758.t1 | isoform | g3758.t1 | 27855509 | 27856129 |
| chr_3 | g3758 | g3758.t1 | exon | g3758.t1.exon1 | 27855509 | 27856129 |
| chr_3 | g3758 | g3758.t1 | cds | g3758.t1.CDS1 | 27855509 | 27856129 |
| chr_3 | g3758 | g3758.t1 | TSS | g3758.t1 | NA | NA |
| chr_3 | g3758 | g3758.t1 | TTS | g3758.t1 | NA | NA |
>g3758.t1 Gene=g3758 Length=621
ATGGCAACAATTAAAGTTTCTCAACCACCTCAAACATATTCGCGAACGATTTTTCGACCA
TGGGATACAGTGAAAGAGGAAAAAAGTGAAATAAAAGTGCCAGAATGTAGTTCACAAAGT
TTACAACAAGCTGAAGTCTTAAGTAGATCAATTTTTATGCCAACAATGCCTGAATATTTG
TATATGCCGCCAACACCACCTGCTGATTTTCTCCCAATTGATGCTTACTCGTTAAGCTTT
ATGGAGCAAGAATATATGCGAGTGATGGCTGAAGAAGCTCGTGCAAAAATGATGAGCACA
AAAAAACAAAGACCGAAAAAATTCAAATGTCCACATTGCGATGTCGCAAAATTCTCGAAT
AATGGTCAATTGAAATCTCACATTCGAACACATACTGGCGAGAGGCCATTCAAATGTGAA
ACGTGCGAGAAAACTTTCACAAGAAATGAAGAATTGACTAGACATAAGCGAATTCATTCT
GGAATCCGTCCGTTCGCTTGTCCGACGTGCCAGAAAAAATTCGGAAGAAGAGACCATTTA
AAGAAACATCAAAGAACTCACGCTTCGGCTGAAAGATATAGCACACTTTTACTGCCTGTT
TATGGATATTACGGTTATTAG
>g3758.t1 Gene=g3758 Length=206
MATIKVSQPPQTYSRTIFRPWDTVKEEKSEIKVPECSSQSLQQAEVLSRSIFMPTMPEYL
YMPPTPPADFLPIDAYSLSFMEQEYMRVMAEEARAKMMSTKKQRPKKFKCPHCDVAKFSN
NGQLKSHIRTHTGERPFKCETCEKTFTRNEELTRHKRIHSGIRPFACPTCQKKFGRRDHL
KKHQRTHASAERYSTLLLPVYGYYGY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g3758.t1 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 106 | 136 | 1.1E-11 |
| 13 | g3758.t1 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 137 | 159 | 4.9E-14 |
| 12 | g3758.t1 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 160 | 189 | 2.6E-10 |
| 4 | g3758.t1 | PANTHER | PTHR24409:SF357 | HUCKEBEIN | 70 | 200 | 7.3E-65 |
| 5 | g3758.t1 | PANTHER | PTHR24409 | ZINC FINGER PROTEIN 142 | 70 | 200 | 7.3E-65 |
| 1 | g3758.t1 | Pfam | PF00096 | Zinc finger, C2H2 type | 108 | 131 | 4.7E-5 |
| 2 | g3758.t1 | Pfam | PF00096 | Zinc finger, C2H2 type | 137 | 159 | 5.8E-6 |
| 3 | g3758.t1 | Pfam | PF00096 | Zinc finger, C2H2 type | 165 | 187 | 2.3E-5 |
| 10 | g3758.t1 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 139 | 159 | - |
| 11 | g3758.t1 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 167 | 187 | - |
| 16 | g3758.t1 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 108 | 136 | 11.302 |
| 17 | g3758.t1 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 137 | 164 | 15.999 |
| 15 | g3758.t1 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 165 | 192 | 12.986 |
| 7 | g3758.t1 | SMART | SM00355 | c2h2final6 | 108 | 131 | 0.0035 |
| 8 | g3758.t1 | SMART | SM00355 | c2h2final6 | 137 | 159 | 9.5E-4 |
| 9 | g3758.t1 | SMART | SM00355 | c2h2final6 | 165 | 187 | 7.6E-4 |
| 6 | g3758.t1 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 118 | 174 | 3.03E-20 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed