General information for g3765.t6
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Protein groucho.
Parent gene
- The parent gene g3765 is located on chr_3: 27911436..27912026 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3765 | g3765.t6 | isoform | g3765.t6 | 27911436 | 27912026 |
| chr_3 | g3765 | g3765.t6 | exon | g3765.t6.exon1 | 27911436 | 27911597 |
| chr_3 | g3765 | g3765.t6 | exon | g3765.t6.exon2 | 27911658 | 27911857 |
| chr_3 | g3765 | g3765.t6 | cds | g3765.t6.CDS1 | 27911678 | 27911857 |
| chr_3 | g3765 | g3765.t6 | exon | g3765.t6.exon3 | 27911919 | 27912026 |
| chr_3 | g3765 | g3765.t6 | cds | g3765.t6.CDS2 | 27911919 | 27912026 |
| chr_3 | g3765 | g3765.t6 | TSS | g3765.t6 | NA | NA |
| chr_3 | g3765 | g3765.t6 | TTS | g3765.t6 | NA | NA |
Sequences
>g3765.t6 Gene=g3765 Length=470
ATACTGATGGTGCATCATGTATTGACATTTGTTCAGATGGTACGAAACTATGGACTGGTG
GTTTAGATAATACAGTAAGATCATGGGATCTTCGTGAAGGAAGACAACTGCAACAGCATG
ATTTTTCATCTCAAATCTTTTCATTGGGTTATTGTCCAACTGGTGATTGGCTTGCAGTCG
GGATGGAAAATTCAAATGTCGAAGTATTGCATGCTCAAAAGTCTGAAAAGTATCAGCTTC
ATTTACATGAAAGTTGTGTTCTGAGTCTTAAATTTGCTGCTTGCGGCAAATGGTTCGTTT
CGACTGGTAAAGATAATCTTTTGAATGCTTGGAAAACTCCTTATGGCGCAAGTATCTTTC
AGTCTAAAGAAACGTCATCAGTATTGAGTTGTGATATATCAGCTGATGATAAATATATTG
TTACTGGATCTGGTGACAAAAAGGCCTCAGTTTATGAAGTCATATACTAA
>g3765.t6 Gene=g3765 Length=95
MENSNVEVLHAQKSEKYQLHLHESCVLSLKFAACGKWFVSTGKDNLLNAWKTPYGASIFQ
SKETSSVLSCDISADDKYIVTGSGDKKASVYEVIY
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g3765.t6 | Gene3D | G3DSA:2.130.10.10 | - | 1 | 95 | 0.0000 |
| 3 | g3765.t6 | PANTHER | PTHR10814:SF21 | PROTEIN GROUCHO | 1 | 95 | 0.0000 |
| 4 | g3765.t6 | PANTHER | PTHR10814 | TRANSDUCIN-LIKE ENHANCER PROTEIN | 1 | 95 | 0.0000 |
| 6 | g3765.t6 | PRINTS | PR01850 | Groucho/transducin-like enhancer protein signature | 17 | 35 | 0.0000 |
| 8 | g3765.t6 | PRINTS | PR01850 | Groucho/transducin-like enhancer protein signature | 36 | 55 | 0.0000 |
| 5 | g3765.t6 | PRINTS | PR01850 | Groucho/transducin-like enhancer protein signature | 56 | 75 | 0.0000 |
| 7 | g3765.t6 | PRINTS | PR01850 | Groucho/transducin-like enhancer protein signature | 76 | 95 | 0.0000 |
| 1 | g3765.t6 | Pfam | PF00400 | WD domain, G-beta repeat | 22 | 50 | 0.0930 |
| 2 | g3765.t6 | Pfam | PF00400 | WD domain, G-beta repeat | 65 | 91 | 0.2400 |
| 13 | g3765.t6 | ProSiteProfiles | PS50294 | Trp-Asp (WD) repeats circular profile. | 19 | 95 | 9.4670 |
| 14 | g3765.t6 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 19 | 60 | 8.7370 |
| 11 | g3765.t6 | SMART | SM00320 | WD40_4 | 12 | 51 | 0.0079 |
| 10 | g3765.t6 | SMART | SM00320 | WD40_4 | 52 | 92 | 0.2300 |
| 9 | g3765.t6 | SUPERFAMILY | SSF50978 | WD40 repeat-like | 12 | 92 | 0.0000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005634 | nucleus | CC |
| GO:0005515 | protein binding | MF |
| GO:0006355 | regulation of transcription, DNA-templated | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
