| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g3791 | g3791.t10 | TTS | g3791.t10 | 27969226 | 27969226 |
| chr_3 | g3791 | g3791.t10 | isoform | g3791.t10 | 27969305 | 27969693 |
| chr_3 | g3791 | g3791.t10 | exon | g3791.t10.exon1 | 27969305 | 27969478 |
| chr_3 | g3791 | g3791.t10 | cds | g3791.t10.CDS1 | 27969305 | 27969478 |
| chr_3 | g3791 | g3791.t10 | exon | g3791.t10.exon2 | 27969532 | 27969693 |
| chr_3 | g3791 | g3791.t10 | cds | g3791.t10.CDS2 | 27969532 | 27969585 |
| chr_3 | g3791 | g3791.t10 | TSS | g3791.t10 | 27970567 | 27970567 |
>g3791.t10 Gene=g3791 Length=336
GATGCTTTCCTTGCTTCAGAATCATTGATTAAACAAATTCCAAGATTGTTGGGTCCAGGT
TTGAACAAGGCTGGTAAATTCCCTGGTTTATTGCAACACAATGAATCAATGACTCAAAAA
ATTGATGAAGTTAAGGCAACAATCAAGTTCCAAATGAAGAAGAAGGTCTTGTGTCTCTCA
GTCGCTGTTGGTCATGTTAACATGACACCTGATGAGCTCGCTCAAAATGTTCACTTGTCA
ATCAACTTCATGGTTTCGCTTTTGAAGAAGCACTGGCAAAATGTGCGTTCACTTCATATT
AAATCATCAATGGGACCACCACAACGTCTCTATTAA
>g3791.t10 Gene=g3791 Length=75
MTQKIDEVKATIKFQMKKKVLCLSVAVGHVNMTPDELAQNVHLSINFMVSLLKKHWQNVR
SLHIKSSMGPPQRLY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g3791.t10 | CDD | cd00403 | Ribosomal_L1 | 1 | 74 | 0 |
| 5 | g3791.t10 | Gene3D | G3DSA:3.30.190.20 | - | 1 | 73 | 0 |
| 2 | g3791.t10 | PANTHER | PTHR23105:SF154 | 60S RIBOSOMAL PROTEIN L10A | 1 | 74 | 0 |
| 3 | g3791.t10 | PANTHER | PTHR23105 | RIBOSOMAL PROTEIN L7AE FAMILY MEMBER | 1 | 74 | 0 |
| 1 | g3791.t10 | Pfam | PF00687 | Ribosomal protein L1p/L10e family | 2 | 70 | 0 |
| 4 | g3791.t10 | SUPERFAMILY | SSF56808 | Ribosomal protein L1 | 2 | 75 | 0 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed