General information for g4013.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g4013 is located on chr_3: 29517114..29517775 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4013 | g4013.t2 | TTS | g4013.t2 | 29516270 | 29516270 |
| chr_3 | g4013 | g4013.t2 | isoform | g4013.t2 | 29517114 | 29517775 |
| chr_3 | g4013 | g4013.t2 | exon | g4013.t2.exon1 | 29517114 | 29517212 |
| chr_3 | g4013 | g4013.t2 | cds | g4013.t2.CDS1 | 29517114 | 29517212 |
| chr_3 | g4013 | g4013.t2 | exon | g4013.t2.exon2 | 29517281 | 29517351 |
| chr_3 | g4013 | g4013.t2 | cds | g4013.t2.CDS2 | 29517281 | 29517351 |
| chr_3 | g4013 | g4013.t2 | exon | g4013.t2.exon3 | 29517413 | 29517481 |
| chr_3 | g4013 | g4013.t2 | cds | g4013.t2.CDS3 | 29517413 | 29517481 |
| chr_3 | g4013 | g4013.t2 | exon | g4013.t2.exon4 | 29517544 | 29517684 |
| chr_3 | g4013 | g4013.t2 | cds | g4013.t2.CDS4 | 29517544 | 29517684 |
| chr_3 | g4013 | g4013.t2 | exon | g4013.t2.exon5 | 29517739 | 29517775 |
| chr_3 | g4013 | g4013.t2 | cds | g4013.t2.CDS5 | 29517739 | 29517775 |
| chr_3 | g4013 | g4013.t2 | TSS | g4013.t2 | 29517808 | 29517808 |
Sequences
>g4013.t2 Gene=g4013 Length=417
ATGAAAAAGTTTTTGATAGCATTAATTATAATTTCTGTTTTAACAGTGAAAGCAGACGAA
GAAGAATTTGATTGGAATTGGGAAGCAGGTATTCCACATTATCAAAAACCTCATTATAAT
GAACAAGGTGAAGTTTTATTCTTTCCAAGAATCATAGGTGGACAAATTGCAGTACATGGT
GAATTTCCTGCAAAAATTTCACTTCAAAATCGTCGTGGTAATCATTTTTGCGGTGGTGCA
CTAATAGATCTACGTCATGTTTTGAGCGCAGCACATTGTTTAACTGATATTGACGGTCGA
GTTTCAAATCCAAATGATATTCGATTAATGGGCGATGATCTTTCAATAGAAAGTCGAGCT
TCACCTCATCGTCAGATATGTGACGCATATTTTCGCACATCCAAGTTACGATTTTGA
>g4013.t2 Gene=g4013 Length=138
MKKFLIALIIISVLTVKADEEEFDWNWEAGIPHYQKPHYNEQGEVLFFPRIIGGQIAVHG
EFPAKISLQNRRGNHFCGGALIDLRHVLSAAHCLTDIDGRVSNPNDIRLMGDDLSIESRA
SPHRQICDAYFRTSKLRF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g4013.t2 | Gene3D | G3DSA:2.40.10.10 | - | 51 | 62 | 4.0E-15 |
| 5 | g4013.t2 | Gene3D | G3DSA:2.40.10.10 | - | 63 | 127 | 4.0E-15 |
| 1 | g4013.t2 | Pfam | PF00089 | Trypsin | 51 | 108 | 7.3E-12 |
| 8 | g4013.t2 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 18 | - |
| 9 | g4013.t2 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 10 | g4013.t2 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 14 | - |
| 11 | g4013.t2 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 15 | 18 | - |
| 7 | g4013.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 19 | 138 | - |
| 3 | g4013.t2 | ProSitePatterns | PS00134 | Serine proteases, trypsin family, histidine active site. | 88 | 93 | - |
| 2 | g4013.t2 | SUPERFAMILY | SSF50494 | Trypsin-like serine proteases | 2 | 125 | 1.22E-18 |
| 4 | g4013.t2 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 18 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | MF |
| GO:0006508 | proteolysis | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed