Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g4022 g4022.t1 isoform g4022.t1 29556720 29557258
chr_3 g4022 g4022.t1 exon g4022.t1.exon1 29556720 29556775
chr_3 g4022 g4022.t1 cds g4022.t1.CDS1 29556720 29556775
chr_3 g4022 g4022.t1 exon g4022.t1.exon2 29557003 29557010
chr_3 g4022 g4022.t1 cds g4022.t1.CDS2 29557003 29557010
chr_3 g4022 g4022.t1 exon g4022.t1.exon3 29557068 29557258
chr_3 g4022 g4022.t1 cds g4022.t1.CDS3 29557068 29557258
chr_3 g4022 g4022.t1 TSS g4022.t1 NA NA
chr_3 g4022 g4022.t1 TTS g4022.t1 NA NA

Sequences

>g4022.t1 Gene=g4022 Length=255
ATGCTTTCATACAACTCCAGTGAATACAACTTTTTGGGTAAAAAGCAAGAAACAAGATTT
ACATCTCCTGAAGTTATAGATAACTGGATTGTTACTAGTGACAGTGATCATAATGAAGGA
CATAGCAAATGTACTTTTAAAACAAGTGCAGCTGGCTATGGCTTATGGAGTGGAGTTGTA
ACTTCATTATTGCCTCAAGATGGTCGAATTAAAAAAAGCCGGATATTGCAGTATAAGAAG
CCAAAGACATACTAA

>g4022.t1 Gene=g4022 Length=84
MLSYNSSEYNFLGKKQETRFTSPEVIDNWIVTSDSDHNEGHSKCTFKTSAAGYGLWSGVV
TSLLPQDGRIKKSRILQYKKPKTY

Protein features from InterProScan

No InterPro annotations for this transcript.

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed