General information for g4091.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Polyubiquitin-B.
Parent gene
- The parent gene g4091 is located on chr_3: 30516962..30522060 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4091 | g4091.t1 | isoform | g4091.t1 | 30515665 | 30516962 |
| chr_3 | g4091 | g4091.t1 | exon | g4091.t1.exon1 | 30515665 | 30515967 |
| chr_3 | g4091 | g4091.t1 | cds | g4091.t1.CDS1 | 30515665 | 30515967 |
| chr_3 | g4091 | g4091.t1 | exon | g4091.t1.exon2 | 30516012 | 30516060 |
| chr_3 | g4091 | g4091.t1 | cds | g4091.t1.CDS2 | 30516012 | 30516060 |
| chr_3 | g4091 | g4091.t1 | exon | g4091.t1.exon3 | 30516775 | 30516781 |
| chr_3 | g4091 | g4091.t1 | cds | g4091.t1.CDS3 | 30516775 | 30516781 |
| chr_3 | g4091 | g4091.t1 | exon | g4091.t1.exon4 | 30516959 | 30516962 |
| chr_3 | g4091 | g4091.t1 | cds | g4091.t1.CDS4 | 30516959 | 30516962 |
| chr_3 | g4091 | g4091.t1 | TSS | g4091.t1 | 30517967 | 30517967 |
| chr_3 | g4091 | g4091.t1 | TTS | g4091.t1 | NA | NA |
Sequences
>g4091.t1 Gene=g4091 Length=363
ATGATAATCATCATGCAAATCTTCGTTAAAACTTTGACTGGCAAGACCATCACACTCGAA
GACAAAGAAGGAATTCCACCAGATCAACAACGTCTTATCTTTGCTGGAAAACAATTGGAA
GACGGCCGCACTTTAAGCGATTACAATATTCAAAAGGAATCAACATTGCATTTGGTTCTT
CGTCTTCGTGGCGGTATGCAAATCTTTGTAAAGACTTTGACTGGCAAAACAATCACACTC
GAAGTTGAGCCATCAGACACAATTGAAAATGTCAAAGCAAAAATCCAGGACAAAGAAGGA
ATTCCACCAGATCAACAACGTCTTATCTCGCTGGAAAACAATTGGAAGACGGCCGCACTT
TAA
>g4091.t1 Gene=g4091 Length=120
MIIIMQIFVKTLTGKTITLEDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
RLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLISLENNWKTAAL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g4091.t1 | Gene3D | G3DSA:3.10.20.90 | - | 3 | 64 | 0.000 |
| 14 | g4091.t1 | Gene3D | G3DSA:3.10.20.90 | - | 65 | 112 | 0.000 |
| 4 | g4091.t1 | PANTHER | PTHR10666 | UBIQUITIN | 5 | 65 | 0.000 |
| 6 | g4091.t1 | PANTHER | PTHR10666:SF365 | POLYUBIQUITIN-LIKE | 5 | 65 | 0.000 |
| 3 | g4091.t1 | PANTHER | PTHR10666 | UBIQUITIN | 21 | 109 | 0.000 |
| 5 | g4091.t1 | PANTHER | PTHR10666:SF365 | POLYUBIQUITIN-LIKE | 21 | 109 | 0.000 |
| 8 | g4091.t1 | PRINTS | PR00348 | Ubiquitin signature | 21 | 41 | 0.000 |
| 7 | g4091.t1 | PRINTS | PR00348 | Ubiquitin signature | 42 | 63 | 0.000 |
| 2 | g4091.t1 | Pfam | PF00240 | Ubiquitin family | 19 | 63 | 0.000 |
| 1 | g4091.t1 | Pfam | PF00240 | Ubiquitin family | 68 | 109 | 0.000 |
| 15 | g4091.t1 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 19 | 65 | 20.719 |
| 16 | g4091.t1 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 66 | 109 | 16.385 |
| 11 | g4091.t1 | SMART | SM00213 | ubq_7 | 5 | 61 | 0.000 |
| 12 | g4091.t1 | SMART | SM00213 | ubq_7 | 66 | 119 | 0.000 |
| 10 | g4091.t1 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 4 | 65 | 0.000 |
| 9 | g4091.t1 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 65 | 109 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
