| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4140 | g4140.t5 | TSS | g4140.t5 | 30903892 | 30903892 |
| chr_3 | g4140 | g4140.t5 | isoform | g4140.t5 | 30904128 | 30906789 |
| chr_3 | g4140 | g4140.t5 | exon | g4140.t5.exon1 | 30904128 | 30904267 |
| chr_3 | g4140 | g4140.t5 | cds | g4140.t5.CDS1 | 30904128 | 30904267 |
| chr_3 | g4140 | g4140.t5 | exon | g4140.t5.exon2 | 30905882 | 30905939 |
| chr_3 | g4140 | g4140.t5 | cds | g4140.t5.CDS2 | 30905882 | 30905939 |
| chr_3 | g4140 | g4140.t5 | exon | g4140.t5.exon3 | 30906000 | 30906142 |
| chr_3 | g4140 | g4140.t5 | cds | g4140.t5.CDS3 | 30906000 | 30906142 |
| chr_3 | g4140 | g4140.t5 | exon | g4140.t5.exon4 | 30906342 | 30906515 |
| chr_3 | g4140 | g4140.t5 | cds | g4140.t5.CDS4 | 30906342 | 30906396 |
| chr_3 | g4140 | g4140.t5 | exon | g4140.t5.exon5 | 30906581 | 30906789 |
| chr_3 | g4140 | g4140.t5 | TTS | g4140.t5 | 30906883 | 30906883 |
>g4140.t5 Gene=g4140 Length=724
ATGCTACGAAATATAAAATCTAAAATATACATATGGATTGAAATTATTATAAGGCTTGCT
CTCTTTGTAGCTTTTTTGAAATTAGAGACATTAGAGCCTTTTCAAAGGAAAATTTTAGCT
GATGATTTATGGAATTATCGTTATCCTAATAAAAAATCATACGTTCCAGTTACATTGTTA
TGGCCAATTCTCACTCTTATCCCAACTTTTGTGTTTATTTTAAATTATATTTTTACGAGA
CATTCAAAAGATTTAAAAGCAGCTATGCTTGGTCATACTTTAGCATTTGGACTTAATGGT
GTTTTAGTAGGTGAGAAAATTCCTTTTATATTTAAATGTTTTTTTGGATGGCAGGAAAAG
TTTCCCGAGCGGTCATTCCTCATTCTCATTCGCTAGTTTAGGATTTTTGACTTTTTATTT
AATTGGAAAGTTGAAAATATTTTCGGATGAAGGAAGAGGAAACAGTTTAAAACTTATAAT
TTCATTTTTTCCTTTTATTGTTGCCATGTTAATAGCAATATCAAGAACATGTGACTATCA
TCATTGGAAAGAAGATGTTGTCGTTGGAAGTTTAATTGGTATTTTAATTGCATATTTATG
CTATCGACAATTTTTTCCACCACTTGCGAGTAAAAAATCAAATTTATGCTATGAAATGCT
TTACCATCTTTCTGCTACAAATGACTCAAATGATCTTCTCGAAAAAGACATTAAATGGAT
CTAA
>g4140.t5 Gene=g4140 Length=131
MLRNIKSKIYIWIEIIIRLALFVAFLKLETLEPFQRKILADDLWNYRYPNKKSYVPVTLL
WPILTLIPTFVFILNYIFTRHSKDLKAAMLGHTLAFGLNGVLVGEKIPFIFKCFFGWQEK
FPERSFLILIR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g4140.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 8 | - |
| 6 | g4140.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 26 | - |
| 5 | g4140.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 27 | 58 | - |
| 7 | g4140.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 78 | - |
| 4 | g4140.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 79 | 131 | - |
| 1 | g4140.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 26 | - |
| 2 | g4140.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 79 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed