General information for g4155.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g4155 is located on chr_3: 31026579..31027215 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4155 | g4155.t1 | TSS | g4155.t1 | 31020408 | 31020408 |
| chr_3 | g4155 | g4155.t1 | isoform | g4155.t1 | 31020547 | 31026797 |
| chr_3 | g4155 | g4155.t1 | exon | g4155.t1.exon1 | 31020547 | 31020612 |
| chr_3 | g4155 | g4155.t1 | cds | g4155.t1.CDS1 | 31020547 | 31020612 |
| chr_3 | g4155 | g4155.t1 | exon | g4155.t1.exon2 | 31025826 | 31025976 |
| chr_3 | g4155 | g4155.t1 | cds | g4155.t1.CDS2 | 31025826 | 31025976 |
| chr_3 | g4155 | g4155.t1 | exon | g4155.t1.exon3 | 31026100 | 31026506 |
| chr_3 | g4155 | g4155.t1 | cds | g4155.t1.CDS3 | 31026100 | 31026506 |
| chr_3 | g4155 | g4155.t1 | exon | g4155.t1.exon4 | 31026572 | 31026627 |
| chr_3 | g4155 | g4155.t1 | cds | g4155.t1.CDS4 | 31026572 | 31026627 |
| chr_3 | g4155 | g4155.t1 | exon | g4155.t1.exon5 | 31026788 | 31026797 |
| chr_3 | g4155 | g4155.t1 | cds | g4155.t1.CDS5 | 31026788 | 31026797 |
| chr_3 | g4155 | g4155.t1 | TTS | g4155.t1 | 31027208 | 31027208 |
Sequences
>g4155.t1 Gene=g4155 Length=690
ATGGGTTTAGATTGTGGAGCAAGTTTGATTAAATATGTTCTTTTTATATTCAATTTAATC
TGTGCGATTGGCGGTATTGCTTTGATGGTAGTAGGTGGAATAGCACTAAAGAAAATTGGA
GATGTAAAAGAAGTATTTGAGGACGGAAATCATCCTGGTATTTTTCCTGCATTCATTATA
GCAATTGGAGCATTGGTCTTTGTTATTGCATTTTTCGGTTGTTGTGGAGCTATTCGTGAA
TCGCAATGTCTTCTCAACCTCTATTCATTGTGTCTACTTTGCCTTGTCGTTTTGCAAGTA
GTGCTTGCAATTTTTGTCTTTGTCTATAATGAAGATGTTCAAAGAGGCGCCCTTAAGGGA
TGGGATAAAATCTGGAGTGGTCGCCAACAAGGACCTCTTAATGATCAAGCGATTAATCAA
ATTCAACGAGCTTTGCAATGCTGTGGAAGTACGACTTTTTTGGACTATGGTGTGACTTTA
CCTAGTAGCTGTTGTGATCCAGAAGCATCTTCTTGTAATCAACTAGTTGCATATAAAACA
GGATGTCGACCACAAATCAAATATGTCGTTCAAAATTCAGCTCAATGGATTGCCTATTTA
TCGATCATTATGGCCCTTGTTGAGCTGGTTGGAGTAATTTTTGGTTGCTGTCTTAGCTCA
AACATTCGAAATTCATCTAGATATGAGTAA
>g4155.t1 Gene=g4155 Length=229
MGLDCGASLIKYVLFIFNLICAIGGIALMVVGGIALKKIGDVKEVFEDGNHPGIFPAFII
AIGALVFVIAFFGCCGAIRESQCLLNLYSLCLLCLVVLQVVLAIFVFVYNEDVQRGALKG
WDKIWSGRQQGPLNDQAINQIQRALQCCGSTTFLDYGVTLPSSCCDPEASSCNQLVAYKT
GCRPQIKYVVQNSAQWIAYLSIIMALVELVGVIFGCCLSSNIRNSSRYE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 20 | g4155.t1 | CDD | cd03127 | tetraspanin_LEL | 107 | 187 | 2.24958E-13 |
| 9 | g4155.t1 | Gene3D | G3DSA:1.10.1450.10 | Tetraspanin | 110 | 191 | 1.1E-8 |
| 2 | g4155.t1 | PANTHER | PTHR19282:SF273 | TETRASPANIN | 4 | 225 | 5.3E-36 |
| 3 | g4155.t1 | PANTHER | PTHR19282 | TETRASPANIN | 4 | 225 | 5.3E-36 |
| 19 | g4155.t1 | PIRSF | PIRSF002419 | Tetraspanin | 1 | 229 | 4.3E-49 |
| 5 | g4155.t1 | PRINTS | PR00259 | Transmembrane four family signature | 12 | 35 | 7.3E-31 |
| 4 | g4155.t1 | PRINTS | PR00259 | Transmembrane four family signature | 52 | 78 | 7.3E-31 |
| 7 | g4155.t1 | PRINTS | PR00259 | Transmembrane four family signature | 79 | 107 | 7.3E-31 |
| 6 | g4155.t1 | PRINTS | PR00259 | Transmembrane four family signature | 196 | 222 | 7.3E-31 |
| 1 | g4155.t1 | Pfam | PF00335 | Tetraspanin family | 10 | 219 | 1.3E-44 |
| 10 | g4155.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 18 | g4155.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 14 | g4155.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 35 | 53 | - |
| 17 | g4155.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 78 | - |
| 11 | g4155.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 79 | 84 | - |
| 16 | g4155.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 109 | - |
| 13 | g4155.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 110 | 195 | - |
| 15 | g4155.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 196 | 218 | - |
| 12 | g4155.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 219 | 229 | - |
| 25 | g4155.t1 | ProSitePatterns | PS00421 | Transmembrane 4 family signature. | 63 | 85 | - |
| 8 | g4155.t1 | SUPERFAMILY | SSF48652 | Tetraspanin | 107 | 190 | 1.24E-12 |
| 23 | g4155.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 21 | g4155.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 77 | - |
| 24 | g4155.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
| 22 | g4155.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 196 | 218 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K06497 (CD63 antigen)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
