| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4155 | g4155.t17 | isoform | g4155.t17 | 31025824 | 31026313 |
| chr_3 | g4155 | g4155.t17 | exon | g4155.t17.exon1 | 31025824 | 31025976 |
| chr_3 | g4155 | g4155.t17 | cds | g4155.t17.CDS1 | 31025844 | 31025976 |
| chr_3 | g4155 | g4155.t17 | exon | g4155.t17.exon2 | 31026100 | 31026313 |
| chr_3 | g4155 | g4155.t17 | cds | g4155.t17.CDS2 | 31026100 | 31026311 |
| chr_3 | g4155 | g4155.t17 | TTS | g4155.t17 | 31027208 | 31027208 |
| chr_3 | g4155 | g4155.t17 | TSS | g4155.t17 | NA | NA |
>g4155.t17 Gene=g4155 Length=367
AGATTGGCGGTATTGCTTTGATGGTAGTAGGTGGAATAGCACTAAAGAAAATTGGAGATG
TAAAAGAAGTATTTGAGGACGGAAATCATCCTGGTATTTTTCCTGCATTCATTATAGCAA
TTGGAGCATTGGTCTTTGTTATTGCATTTTTCGGTTGTTGTGGAGCTATTCGTGAATCGC
AATGTCTTCTCAACCTCTATTCATTGTGTCTACTTTGCCTTGTCGTTTTGCAAGTAGTGC
TTGCAATTTTTGTCTTTGTCTATAATGAAGATGTTCAAAGAGGCGCCCTTAAGGGATGGG
ATAAAATCTGGAGTGGTCGCCAACAAGGACCTCTTAATGATCAAGCGATTAATCAAATTC
AACGAGC
>g4155.t17 Gene=g4155 Length=115
MVVGGIALKKIGDVKEVFEDGNHPGIFPAFIIAIGALVFVIAFFGCCGAIRESQCLLNLY
SLCLLCLVVLQVVLAIFVFVYNEDVQRGALKGWDKIWSGRQQGPLNDQAINQIQR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4155.t17 | PANTHER | PTHR19282 | TETRASPANIN | 28 | 113 | 3.5E-14 |
| 4 | g4155.t17 | PRINTS | PR00259 | Transmembrane four family signature | 24 | 50 | 8.7E-16 |
| 3 | g4155.t17 | PRINTS | PR00259 | Transmembrane four family signature | 51 | 79 | 8.7E-16 |
| 1 | g4155.t17 | Pfam | PF00335 | Tetraspanin family | 16 | 114 | 5.0E-22 |
| 9 | g4155.t17 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 25 | - |
| 11 | g4155.t17 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 50 | - |
| 8 | g4155.t17 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 51 | 56 | - |
| 12 | g4155.t17 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 81 | - |
| 10 | g4155.t17 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 82 | 115 | - |
| 7 | g4155.t17 | ProSitePatterns | PS00421 | Transmembrane 4 family signature. | 35 | 57 | - |
| 5 | g4155.t17 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 25 | 47 | - |
| 6 | g4155.t17 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 59 | 81 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
## Warning: Removed 1 row(s) containing missing values (geom_path).
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.