General information for g4155.t21
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g4155 is located on chr_3: 31026579..31027215 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4155 | g4155.t21 | isoform | g4155.t21 | 31025835 | 31026797 |
| chr_3 | g4155 | g4155.t21 | exon | g4155.t21.exon1 | 31025835 | 31025976 |
| chr_3 | g4155 | g4155.t21 | cds | g4155.t21.CDS1 | 31025844 | 31025976 |
| chr_3 | g4155 | g4155.t21 | exon | g4155.t21.exon2 | 31026112 | 31026506 |
| chr_3 | g4155 | g4155.t21 | cds | g4155.t21.CDS2 | 31026112 | 31026506 |
| chr_3 | g4155 | g4155.t21 | exon | g4155.t21.exon3 | 31026572 | 31026627 |
| chr_3 | g4155 | g4155.t21 | cds | g4155.t21.CDS3 | 31026572 | 31026627 |
| chr_3 | g4155 | g4155.t21 | exon | g4155.t21.exon4 | 31026788 | 31026797 |
| chr_3 | g4155 | g4155.t21 | cds | g4155.t21.CDS4 | 31026788 | 31026797 |
| chr_3 | g4155 | g4155.t21 | TTS | g4155.t21 | 31027208 | 31027208 |
| chr_3 | g4155 | g4155.t21 | TSS | g4155.t21 | NA | NA |
Sequences
>g4155.t21 Gene=g4155 Length=603
ATTGCTTTGATGGTAGTAGGTGGAATAGCACTAAAGAAAATTGGAGATGTAAAAGAAGTA
TTTGAGGACGGAAATCATCCTGGTATTTTTCCTGCATTCATTATAGCAATTGGAGCATTG
GTCTTTGTTATTGCATTTTTCGCTATTCGTGAATCGCAATGTCTTCTCAACCTCTATTCA
TTGTGTCTACTTTGCCTTGTCGTTTTGCAAGTAGTGCTTGCAATTTTTGTCTTTGTCTAT
AATGAAGATGTTCAAAGAGGCGCCCTTAAGGGATGGGATAAAATCTGGAGTGGTCGCCAA
CAAGGACCTCTTAATGATCAAGCGATTAATCAAATTCAACGAGCTTTGCAATGCTGTGGA
AGTACGACTTTTTTGGACTATGGTGTGACTTTACCTAGTAGCTGTTGTGATCCAGAAGCA
TCTTCTTGTAATCAACTAGTTGCATATAAAACAGGATGTCGACCACAAATCAAATATGTC
GTTCAAAATTCAGCTCAATGGATTGCCTATTTATCGATCATTATGGCCCTTGTTGAGCTG
GTTGGAGTAATTTTTGGTTGCTGTCTTAGCTCAAACATTCGAAATTCATCTAGATATGAG
TAA
>g4155.t21 Gene=g4155 Length=197
MVVGGIALKKIGDVKEVFEDGNHPGIFPAFIIAIGALVFVIAFFAIRESQCLLNLYSLCL
LCLVVLQVVLAIFVFVYNEDVQRGALKGWDKIWSGRQQGPLNDQAINQIQRALQCCGSTT
FLDYGVTLPSSCCDPEASSCNQLVAYKTGCRPQIKYVVQNSAQWIAYLSIIMALVELVGV
IFGCCLSSNIRNSSRYE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 16 | g4155.t21 | CDD | cd03127 | tetraspanin_LEL | 75 | 155 | 4.82332E-14 |
| 7 | g4155.t21 | Gene3D | G3DSA:1.10.1450.10 | Tetraspanin | 78 | 159 | 8.7E-9 |
| 2 | g4155.t21 | PANTHER | PTHR19282 | TETRASPANIN | 26 | 193 | 3.0E-21 |
| 3 | g4155.t21 | PANTHER | PTHR19282:SF471 | CD63 ANTIGEN | 26 | 193 | 3.0E-21 |
| 15 | g4155.t21 | PIRSF | PIRSF002419 | Tetraspanin | 8 | 197 | 1.5E-36 |
| 5 | g4155.t21 | PRINTS | PR00259 | Transmembrane four family signature | 47 | 75 | 4.2E-15 |
| 4 | g4155.t21 | PRINTS | PR00259 | Transmembrane four family signature | 164 | 190 | 4.2E-15 |
| 1 | g4155.t21 | Pfam | PF00335 | Tetraspanin family | 16 | 187 | 1.1E-31 |
| 11 | g4155.t21 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 25 | - |
| 14 | g4155.t21 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 46 | - |
| 9 | g4155.t21 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 47 | 52 | - |
| 12 | g4155.t21 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 77 | - |
| 10 | g4155.t21 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 78 | 163 | - |
| 13 | g4155.t21 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 164 | 186 | - |
| 8 | g4155.t21 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 187 | 197 | - |
| 6 | g4155.t21 | SUPERFAMILY | SSF48652 | Tetraspanin | 75 | 158 | 8.76E-13 |
| 18 | g4155.t21 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 24 | 46 | - |
| 17 | g4155.t21 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 19 | g4155.t21 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 164 | 186 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
## Warning: Removed 1 row(s) containing missing values (geom_path).
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed