General information for g4160.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein 4.
Parent gene
- The parent gene g4160 is located on chr_3: 31059263..31060117 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4160 | g4160.t1 | TSS | g4160.t1 | 31056133 | 31056133 |
| chr_3 | g4160 | g4160.t1 | isoform | g4160.t1 | 31056186 | 31060117 |
| chr_3 | g4160 | g4160.t1 | exon | g4160.t1.exon1 | 31056186 | 31056246 |
| chr_3 | g4160 | g4160.t1 | cds | g4160.t1.CDS1 | 31056186 | 31056246 |
| chr_3 | g4160 | g4160.t1 | exon | g4160.t1.exon2 | 31059264 | 31059454 |
| chr_3 | g4160 | g4160.t1 | cds | g4160.t1.CDS2 | 31059264 | 31059454 |
| chr_3 | g4160 | g4160.t1 | exon | g4160.t1.exon3 | 31059509 | 31059652 |
| chr_3 | g4160 | g4160.t1 | cds | g4160.t1.CDS3 | 31059509 | 31059652 |
| chr_3 | g4160 | g4160.t1 | exon | g4160.t1.exon4 | 31059713 | 31060117 |
| chr_3 | g4160 | g4160.t1 | cds | g4160.t1.CDS4 | 31059713 | 31060117 |
| chr_3 | g4160 | g4160.t1 | TTS | g4160.t1 | 31060149 | 31060149 |
Sequences
>g4160.t1 Gene=g4160 Length=801
ATGGCTTTGGTTTTAAAAAGTGTTTATAAATTTTATAATTATTATTTCAATGAAAATGTT
GATGAAAGAATCAAGGATCTCTTTTTAATAAATTCACCTTGGCCTTTGGTCATAATTGTT
ACTGCATATCTCTATTTTGTCAATGGAAATGGTCAAAAAATGATGAAATATCGAGAGCCT
TTTGAATTAAATGGAATAATAAATATTTATAACATCATACAAGTATTCTTGAATCTTTAT
TTAGCTATTGGGGCAACATGGACATTAATCGGAATTAAAGATTTGAATATTCTATGTATT
CCAGAAGCAAGAAAAATGATTTCGGATGAAGGAAAGAAAATAGTGTATTTTTCTCATCTC
TATTATTTGATTAAAGTTGTAGATTTACTCGATACGATCTTTTTTATCTTAAGAAAGAAA
AACAATCAAGTATCATTTTTGCATATTTATCATCATACGATTATGGTTGTTGGTTGCTAC
ATATACATTAAATTTATGGTCGGCGGAGGACAACCAACCTCTCTCGGAATAATAAATTCT
TTCGTTCATGTCGTCATGTATTCATATTATTTTCTAACATCATTTAAACCTGAGCTTAAG
AAATCAATATGGTGGAAAAAGCATATAACTCAACTTCAAATGACGCAGTTTGCAATTCTA
GTGATTCATTTCCTCATGCCAGTGTTTACCGAATGTGATTACCCTAAAGGGTTATCTGCA
GGAATCGCCTTTCAAAATATATTTATGTTTTTACTTTTTGCTGATTTTTATTATAAAGCT
TATGTAAAAACTAAAAAGTAA
>g4160.t1 Gene=g4160 Length=266
MALVLKSVYKFYNYYFNENVDERIKDLFLINSPWPLVIIVTAYLYFVNGNGQKMMKYREP
FELNGIINIYNIIQVFLNLYLAIGATWTLIGIKDLNILCIPEARKMISDEGKKIVYFSHL
YYLIKVVDLLDTIFFILRKKNNQVSFLHIYHHTIMVVGCYIYIKFMVGGGQPTSLGIINS
FVHVVMYSYYFLTSFKPELKKSIWWKKHITQLQMTQFAILVIHFLMPVFTECDYPKGLSA
GIAFQNIFMFLLFADFYYKAYVKTKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g4160.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 3 | 263 | 3.3E-88 |
| 3 | g4160.t1 | PANTHER | PTHR11157:SF21 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN | 3 | 263 | 3.3E-88 |
| 1 | g4160.t1 | Pfam | PF01151 | GNS1/SUR4 family | 29 | 266 | 1.9E-55 |
| 16 | g4160.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 26 | - |
| 23 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 46 | - |
| 11 | g4160.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 47 | 66 | - |
| 19 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 90 | - |
| 18 | g4160.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 91 | 113 | - |
| 25 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 114 | 137 | - |
| 12 | g4160.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 138 | 148 | - |
| 24 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 149 | 167 | - |
| 15 | g4160.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 168 | 172 | - |
| 20 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 173 | 192 | - |
| 13 | g4160.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 193 | 211 | - |
| 22 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 212 | 230 | - |
| 17 | g4160.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 231 | 241 | - |
| 21 | g4160.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 242 | 258 | - |
| 14 | g4160.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 259 | 266 | - |
| 6 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 49 | - |
| 10 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 69 | 91 | - |
| 9 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 115 | 137 | - |
| 8 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 144 | 163 | - |
| 5 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 173 | 195 | - |
| 7 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 208 | 230 | - |
| 4 | g4160.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 240 | 262 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed