| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g4173 | g4173.t1 | isoform | g4173.t1 | 31219684 | 31219968 |
| chr_3 | g4173 | g4173.t1 | exon | g4173.t1.exon1 | 31219684 | 31219968 |
| chr_3 | g4173 | g4173.t1 | cds | g4173.t1.CDS1 | 31219684 | 31219968 |
| chr_3 | g4173 | g4173.t1 | TSS | g4173.t1 | NA | NA |
| chr_3 | g4173 | g4173.t1 | TTS | g4173.t1 | NA | NA |
>g4173.t1 Gene=g4173 Length=285
ATGAATAATAGATCGAAGAATTCAGACCGTCGCAATAATTCAACAATTGCAGTTAAGAAT
CAACAAGTTGATTCTAACCTCAAATATGCGTCAAATGTTTCGATGGATTTTGGAAATGAT
TCAGTCAAAGAAGATGATAAGTCATCAAAAATTAAACCGATCATTGTGGATAGTGGAATA
GCCCCGAGTTATACCCAAAAAACCGCGGTGAAATGTTCGTTCGTCTGTGAACACGTTACA
GCTCACAGATTTCACTTTTTCGTCAAAATTCTTGAATATTCATAA
>g4173.t1 Gene=g4173 Length=94
MNNRSKNSDRRNNSTIAVKNQQVDSNLKYASNVSMDFGNDSVKEDDKSSKIKPIIVDSGI
APSYTQKTAVKCSFVCEHVTAHRFHFFVKILEYS
No InterPro annotations for this transcript.
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed