Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative CD63 antigen.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g4424 g4424.t4 TTS g4424.t4 2114178 2114178
chr_2 g4424 g4424.t4 isoform g4424.t4 2114568 2115133
chr_2 g4424 g4424.t4 exon g4424.t4.exon1 2114568 2114767
chr_2 g4424 g4424.t4 cds g4424.t4.CDS1 2114570 2114767
chr_2 g4424 g4424.t4 exon g4424.t4.exon2 2114829 2115017
chr_2 g4424 g4424.t4 cds g4424.t4.CDS2 2114829 2115017
chr_2 g4424 g4424.t4 exon g4424.t4.exon3 2115071 2115133
chr_2 g4424 g4424.t4 cds g4424.t4.CDS3 2115071 2115133
chr_2 g4424 g4424.t4 TSS g4424.t4 2115424 2115424

Sequences

>g4424.t4 Gene=g4424 Length=452
ATGTCTAACACAAGTGAGGCATGCATCAAATATACTTTGTTCATTTTCAACTTTATATTT
GTGATCACTGGGATCATAATTTTGAGTGTAGGCTTGTCAGTCCAAGGAGTCTACCATGGA
TATAGTGAATTTTTGAGCAGTCAATTTTTGACCTTGCCCGTATTTCTTGTCGTTATTGGA
AGCATAATTTTCTTTGTTGCATTCTTTGGCTGCTATGGAGCTATGCGTGAAAATTACTGC
ATGATATTGACTTTTTGTGGATTATTAACAATAATATTTATTCTCGAATTGGCGGCTGGC
ATTACTGGATATATTTTGAAAAATTCTACAAGTTCACTCATTTCAGCTACTCTTGAACCT
ACTATGCATGACTATACGAATCCTGATAAAAAACATATAACTTATGCATGGGATGATATT
CAAAGTAAATTTTCTTGCTGTGGACTTGAAAG

>g4424.t4 Gene=g4424 Length=150
MSNTSEACIKYTLFIFNFIFVITGIIILSVGLSVQGVYHGYSEFLSSQFLTLPVFLVVIG
SIIFFVAFFGCYGAMRENYCMILTFCGLLTIIFILELAAGITGYILKNSTSSLISATLEP
TMHDYTNPDKKHITYAWDDIQSKFSCCGLE

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g4424.t4 Gene3D G3DSA:1.10.1450.10 Tetraspanin 106 150 9.1E-6
2 g4424.t4 PANTHER PTHR19282 TETRASPANIN 4 149 1.4E-36
3 g4424.t4 PANTHER PTHR19282:SF456 TETRASPANIN 4 149 1.4E-36
6 g4424.t4 PRINTS PR00259 Transmembrane four family signature 11 34 4.8E-28
4 g4424.t4 PRINTS PR00259 Transmembrane four family signature 49 75 4.8E-28
5 g4424.t4 PRINTS PR00259 Transmembrane four family signature 76 104 4.8E-28
1 g4424.t4 Pfam PF00335 Tetraspanin family 9 149 6.9E-36
9 g4424.t4 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 11 -
14 g4424.t4 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 12 34 -
12 g4424.t4 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 35 53 -
15 g4424.t4 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 54 75 -
10 g4424.t4 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 76 81 -
13 g4424.t4 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 82 106 -
11 g4424.t4 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 107 150 -
19 g4424.t4 ProSitePatterns PS00421 Transmembrane 4 family signature. 60 82 -
7 g4424.t4 SUPERFAMILY SSF48652 Tetraspanin 104 149 2.75E-6
18 g4424.t4 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 13 35 -
17 g4424.t4 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 50 72 -
16 g4424.t4 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 79 101 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0016021 integral component of membrane CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed