Gene loci information

Transcript annotation

  • This transcript has been annotated as Profilin.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g4530 g4530.t35 TTS g4530.t35 3100907 3100907
chr_2 g4530 g4530.t35 isoform g4530.t35 3101026 3104763
chr_2 g4530 g4530.t35 exon g4530.t35.exon1 3101026 3101123
chr_2 g4530 g4530.t35 cds g4530.t35.CDS1 3101026 3101123
chr_2 g4530 g4530.t35 exon g4530.t35.exon2 3101217 3101376
chr_2 g4530 g4530.t35 cds g4530.t35.CDS2 3101217 3101376
chr_2 g4530 g4530.t35 exon g4530.t35.exon3 3104653 3104763
chr_2 g4530 g4530.t35 cds g4530.t35.CDS3 3104653 3104763
chr_2 g4530 g4530.t35 TSS g4530.t35 3105043 3105043

Sequences

>g4530.t35 Gene=g4530 Length=369
ATGAGTTGGCAAGATTATGTAGATAACCAATTAATAGCATCACAGTGCGTATCAAAGGCC
TGCATTTCTGGCCACGACGGAGGTATTTGGGCGAAATCAGAAGGTTTTGAGGTAACAAAG
GAAGAACTCGCCAAATTAGTACAAGGCTTTGATAAAACTGAAATTTTAACGTCAGGCGGA
GTAACACTCGCCGGACAACGTCACATTTACCTCTCTGGAACAGATCGTGTTATTCGTGCG
AAGTTGGGTAAAGTTGGTGTTCACTGTATGACTGTAATTGTTGCAATTTATGAAGAGCCA
GTTCAGCCACAACAGGCTGCTTCCGTCGTTGAGAAACTTGGAGACTATTTGATCACATGT
GGTTATTAG

>g4530.t35 Gene=g4530 Length=122
MSWQDYVDNQLIASQCVSKACISGHDGGIWAKSEGFEVTKEELAKLVQGFDKTEILTSGG
VTLAGQRHIYLSGTDRVIRAKLGKVGVHCMTVIVAIYEEPVQPQQAASVVEKLGDYLITC
GY

Protein features from InterProScan

Transcript Database ID Name Start End E.value
15 g4530.t35 CDD cd00148 PROF 2 122 7.04031E-45
14 g4530.t35 Gene3D G3DSA:3.30.450.30 Dynein light chain 2a 1 122 2.1E-35
2 g4530.t35 PANTHER PTHR11604 PROFILIN 1 122 7.2E-33
3 g4530.t35 PANTHER PTHR11604:SF0 PROFILIN 1 122 7.2E-33
7 g4530.t35 PRINTS PR01640 Plant profilin signature 1 12 8.5E-14
10 g4530.t35 PRINTS PR00392 Profilin signature 3 12 1.3E-17
9 g4530.t35 PRINTS PR00392 Profilin signature 18 27 1.3E-17
5 g4530.t35 PRINTS PR01640 Plant profilin signature 24 37 8.5E-14
8 g4530.t35 PRINTS PR00392 Profilin signature 36 56 1.3E-17
11 g4530.t35 PRINTS PR00392 Profilin signature 91 104 1.3E-17
4 g4530.t35 PRINTS PR01640 Plant profilin signature 95 108 8.5E-14
12 g4530.t35 PRINTS PR00392 Profilin signature 104 121 1.3E-17
6 g4530.t35 PRINTS PR01640 Plant profilin signature 108 121 8.5E-14
1 g4530.t35 Pfam PF00235 Profilin 1 122 4.1E-36
16 g4530.t35 ProSitePatterns PS00414 Profilin signature. 1 8 -
17 g4530.t35 SMART SM00392 prof_2 1 122 2.7E-50
13 g4530.t35 SUPERFAMILY SSF55770 Profilin (actin-binding protein) 2 122 1.83E-35

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003779 actin binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed