General information for g4530.t36
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Profilin.
Parent gene
- The parent gene g4530 is located on chr_2: 3104653..3105043 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4530 | g4530.t36 | TTS | g4530.t36 | 3100907 | 3100907 |
| chr_2 | g4530 | g4530.t36 | isoform | g4530.t36 | 3101026 | 3104763 |
| chr_2 | g4530 | g4530.t36 | exon | g4530.t36.exon1 | 3101026 | 3101088 |
| chr_2 | g4530 | g4530.t36 | cds | g4530.t36.CDS1 | 3101063 | 3101088 |
| chr_2 | g4530 | g4530.t36 | exon | g4530.t36.exon2 | 3101205 | 3101367 |
| chr_2 | g4530 | g4530.t36 | cds | g4530.t36.CDS2 | 3101205 | 3101367 |
| chr_2 | g4530 | g4530.t36 | exon | g4530.t36.exon3 | 3104653 | 3104763 |
| chr_2 | g4530 | g4530.t36 | cds | g4530.t36.CDS3 | 3104653 | 3104763 |
| chr_2 | g4530 | g4530.t36 | TSS | g4530.t36 | 3105043 | 3105043 |
Sequences
>g4530.t36 Gene=g4530 Length=337
ATGAGTTGGCAAGATTATGTAGATAACCAATTAATAGCATCACAGTGCGTATCAAAGGCC
TGCATTTCTGGCCACGACGGAGGTATTTGGGCGAAATCAGAAGGTTTTGAGGAAGAACTC
GCCAAATTAGTACAAGGCTTTGATAAAACTGAAATTTTAACGTCAGGCGGAGTAACACTC
GCCGGACAACGTCACATTTACCTCTCTGGAACAGATCGTGTTATTCGTGCGAAGTTGGGT
AAAGTTGGTGTTCACTGTATGAAAACACAACAAGCCACAACAGGCTGCTTCCGTCGTTGA
GAAACTTGGAGACTATTTGATCACATGTGGTTATTAG
>g4530.t36 Gene=g4530 Length=99
MSWQDYVDNQLIASQCVSKACISGHDGGIWAKSEGFEEELAKLVQGFDKTEILTSGGVTL
AGQRHIYLSGTDRVIRAKLGKVGVHCMKTQQATTGCFRR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g4530.t36 | CDD | cd00148 | PROF | 2 | 92 | 8.05721E-30 |
| 11 | g4530.t36 | Gene3D | G3DSA:3.30.450.30 | Dynein light chain 2a | 1 | 97 | 2.1E-24 |
| 2 | g4530.t36 | PANTHER | PTHR11604 | PROFILIN | 1 | 92 | 1.8E-21 |
| 3 | g4530.t36 | PANTHER | PTHR11604:SF0 | PROFILIN | 1 | 92 | 1.8E-21 |
| 6 | g4530.t36 | PRINTS | PR01640 | Plant profilin signature | 1 | 12 | 2.3E-8 |
| 9 | g4530.t36 | PRINTS | PR00392 | Profilin signature | 3 | 12 | 2.0E-6 |
| 8 | g4530.t36 | PRINTS | PR00392 | Profilin signature | 18 | 27 | 2.0E-6 |
| 4 | g4530.t36 | PRINTS | PR01640 | Plant profilin signature | 24 | 37 | 2.3E-8 |
| 7 | g4530.t36 | PRINTS | PR00392 | Profilin signature | 57 | 71 | 2.0E-6 |
| 5 | g4530.t36 | PRINTS | PR01640 | Plant profilin signature | 76 | 91 | 2.3E-8 |
| 1 | g4530.t36 | Pfam | PF00235 | Profilin | 1 | 92 | 2.9E-24 |
| 13 | g4530.t36 | ProSitePatterns | PS00414 | Profilin signature. | 1 | 8 | - |
| 14 | g4530.t36 | SMART | SM00392 | prof_2 | 1 | 96 | 8.2E-19 |
| 10 | g4530.t36 | SUPERFAMILY | SSF55770 | Profilin (actin-binding protein) | 2 | 92 | 1.96E-24 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003779 | actin binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed