General information for g4710.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Sodium/potassium-transporting ATPase subunit beta-2.
Parent gene
- The parent gene g4710 is located on chr_2: 4348078..4348437 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4710 | g4710.t2 | TSS | g4710.t2 | 4344326 | 4344326 |
| chr_2 | g4710 | g4710.t2 | isoform | g4710.t2 | 4344433 | 4345083 |
| chr_2 | g4710 | g4710.t2 | exon | g4710.t2.exon1 | 4344433 | 4344490 |
| chr_2 | g4710 | g4710.t2 | cds | g4710.t2.CDS1 | 4344433 | 4344490 |
| chr_2 | g4710 | g4710.t2 | exon | g4710.t2.exon2 | 4344546 | 4344743 |
| chr_2 | g4710 | g4710.t2 | cds | g4710.t2.CDS2 | 4344546 | 4344743 |
| chr_2 | g4710 | g4710.t2 | exon | g4710.t2.exon3 | 4344803 | 4345083 |
| chr_2 | g4710 | g4710.t2 | cds | g4710.t2.CDS3 | 4344803 | 4345083 |
| chr_2 | g4710 | g4710.t2 | TTS | g4710.t2 | NA | NA |
Sequences
>g4710.t2 Gene=g4710 Length=537
ATGTGTCTCAAACATCCTTGTTATGAACGATTAAATCGAATTGCGGCGTCCAAACCATTA
CGAATATTTTATGGCGTCATTCTATTTCTATTCGTTGCCTTTGCTTGTTACCGACTTCTG
CAAGCTTCAAATGACTTGCATGCACAGAAAAATGCTCGATTGGAAGTGATCCCAAATTTT
CAGGACAATTTTATTAAATATGAAGTTAGTTCGGGAGCAAATGACATTGTGGCCAAAATC
AATGACGCGCTAATTCAATACGAGACGCCAAATAAAAACCGCCAAAGATGTGACAACAGT
TTTCCAAGTCAAAATAAATCGTGTGACGTTGATTTAAATGAATTTGGACCATGCACAAAA
GAGAATGGCTATGGATATTATAGAGGATCTCCTTGTGTATTTATAAAACTTAAAAAACTT
GAAAATTGGATACCTCAATGTTTGAACAATAGTAATCCTCTACCTGATGACATGCCAATT
TATTTGAAAAATTATATCAGTAATGATCATAATCGCAATCAAGTGGGTTTTATTTAA
>g4710.t2 Gene=g4710 Length=178
MCLKHPCYERLNRIAASKPLRIFYGVILFLFVAFACYRLLQASNDLHAQKNARLEVIPNF
QDNFIKYEVSSGANDIVAKINDALIQYETPNKNRQRCDNSFPSQNKSCDVDLNEFGPCTK
ENGYGYYRGSPCVFIKLKKLENWIPQCLNNSNPLPDDMPIYLKNYISNDHNRNQVGFI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g4710.t2 | Gene3D | G3DSA:2.60.40.1660 | Na | 21 | 177 | 1.6E-23 |
| 2 | g4710.t2 | PANTHER | PTHR11523:SF46 | SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT BETA-2 | 79 | 172 | 2.8E-20 |
| 3 | g4710.t2 | PANTHER | PTHR11523 | SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNIT | 79 | 172 | 2.8E-20 |
| 1 | g4710.t2 | Pfam | PF00287 | Sodium / potassium ATPase beta chain | 53 | 157 | 3.4E-13 |
| 6 | g4710.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 20 | - |
| 8 | g4710.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 40 | - |
| 7 | g4710.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 41 | 178 | - |
| 4 | g4710.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006813 | potassium ion transport | BP |
| GO:0005890 | sodium:potassium-exchanging ATPase complex | CC |
| GO:0006814 | sodium ion transport | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
