Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Actin-binding protein IPP.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g4791 g4791.t15 TSS g4791.t15 4991262 4991262
chr_2 g4791 g4791.t15 isoform g4791.t15 4991936 4992355
chr_2 g4791 g4791.t15 exon g4791.t15.exon1 4991936 4992138
chr_2 g4791 g4791.t15 cds g4791.t15.CDS1 4991944 4992138
chr_2 g4791 g4791.t15 exon g4791.t15.exon2 4992221 4992355
chr_2 g4791 g4791.t15 cds g4791.t15.CDS2 4992221 4992355
chr_2 g4791 g4791.t15 TTS g4791.t15 4992655 4992655

Sequences

>g4791.t15 Gene=g4791 Length=338
GCTGTCAAATGGGAGTAGCTATACTCGGAAGGCATCTTTATGTAGTAGGAGGCAACTCAA
GTCATCAAGAAGTCCTTCAAAGTGTTGAAAAATATTCCTTTGATGATGATAAATGGACTA
GTGTGTCTCCCATGACAACGGCACGTGCCTCACCAGCAGTTTCATCAGCTGATGGTGTTC
TTTACGTCGCTGGCGGCGATCAGACATGTGAAGTCAACTTTTATCGAGCACAAATCACAA
TAAATTCATTTGAATGTTATAATCCATTGACAGACACGTGGAAGACCTGTCCATCATTAC
CGACGAGTAGAAGTGAAGCGGGCAGTGTTGTGATTTAA

>g4791.t15 Gene=g4791 Length=109
MGVAILGRHLYVVGGNSSHQEVLQSVEKYSFDDDKWTSVSPMTTARASPAVSSADGVLYV
AGGDQTCEVNFYRAQITINSFECYNPLTDTWKTCPSLPTSRSEAGSVVI

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g4791.t15 Gene3D G3DSA:2.120.10.80 - 1 109 0.00000
3 g4791.t15 PANTHER PTHR24412 KELCH PROTEIN 1 108 0.00000
4 g4791.t15 PANTHER PTHR24412:SF210 KELCH-LIKE PROTEIN 18 1 108 0.00000
2 g4791.t15 Pfam PF01344 Kelch motif 2 42 0.00000
1 g4791.t15 Pfam PF01344 Kelch motif 45 98 0.00000
7 g4791.t15 SMART SM00612 kelc_smart 9 56 0.00000
6 g4791.t15 SMART SM00612 kelc_smart 57 109 0.00087
5 g4791.t15 SUPERFAMILY SSF117281 Kelch motif 2 108 0.00000

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005515 protein binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values