| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4868 | g4868.t5 | TSS | g4868.t5 | 5572287 | 5572287 |
| chr_2 | g4868 | g4868.t5 | isoform | g4868.t5 | 5572420 | 5573006 |
| chr_2 | g4868 | g4868.t5 | exon | g4868.t5.exon1 | 5572420 | 5572488 |
| chr_2 | g4868 | g4868.t5 | cds | g4868.t5.CDS1 | 5572420 | 5572488 |
| chr_2 | g4868 | g4868.t5 | exon | g4868.t5.exon2 | 5572677 | 5572845 |
| chr_2 | g4868 | g4868.t5 | cds | g4868.t5.CDS2 | 5572677 | 5572845 |
| chr_2 | g4868 | g4868.t5 | exon | g4868.t5.exon3 | 5572909 | 5573006 |
| chr_2 | g4868 | g4868.t5 | cds | g4868.t5.CDS3 | 5572909 | 5573006 |
| chr_2 | g4868 | g4868.t5 | TTS | g4868.t5 | 5573076 | 5573076 |
>g4868.t5 Gene=g4868 Length=336
ATGGACAAGAGTGAATTGGCCTGTGTTTATGCTGCTTTAATCCTCGTTGATGATGAAATC
GCCATTACTAAAATCTCAACAATCTTGAAGGCTGCCAATGTTGAAGTTGAGCCATACTGG
CCAGGACTTTTTGCAAAGGCCCTTGAAGGAATCGATGTTAAGTCATTGATCACATCAATT
GGATCTGGAGCTGGATCAGGGCCAGCAACAGGCGGAGCAGCACCAGCAGCTGCAGCAGGC
GGTGCACCAGCAGGTGATGCCAAGAAAGAGGAAAAGAAGAAGGAAGAATCTGAACCAGAA
TCAGACGACGACATGGGCTTCGGTCTCTTTGACTAA
>g4868.t5 Gene=g4868 Length=111
MDKSELACVYAALILVDDEIAITKISTILKAANVEVEPYWPGLFAKALEGIDVKSLITSI
GSGAGSGPATGGAAPAAAAGGAPAGDAKKEEKKKEESEPESDDDMGFGLFD
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g4868.t5 | CDD | cd05831 | Ribosomal_P1 | 5 | 110 | 2.26962E-29 |
| 6 | g4868.t5 | Gene3D | G3DSA:1.10.10.1410 | - | 2 | 61 | 1.8E-28 |
| 3 | g4868.t5 | Hamap | MF_01478 | 50S ribosomal protein L12 [rpl12]. | 6 | 111 | 15.308081 |
| 5 | g4868.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 68 | 111 | - |
| 4 | g4868.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 85 | 100 | - |
| 2 | g4868.t5 | PANTHER | PTHR45696 | 60S ACIDIC RIBOSOMAL PROTEIN P1 | 1 | 111 | 9.0E-40 |
| 1 | g4868.t5 | Pfam | PF00428 | 60s Acidic ribosomal protein | 20 | 110 | 1.6E-26 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006414 | translational elongation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed