General information for g4912.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g4912 is located on chr_2: 5931006..5931459 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g4912 | g4912.t1 | isoform | g4912.t1 | 5931006 | 5931459 |
| chr_2 | g4912 | g4912.t1 | exon | g4912.t1.exon1 | 5931006 | 5931059 |
| chr_2 | g4912 | g4912.t1 | cds | g4912.t1.CDS1 | 5931006 | 5931059 |
| chr_2 | g4912 | g4912.t1 | TSS | g4912.t1 | 5931115 | 5931115 |
| chr_2 | g4912 | g4912.t1 | exon | g4912.t1.exon2 | 5931116 | 5931202 |
| chr_2 | g4912 | g4912.t1 | cds | g4912.t1.CDS2 | 5931116 | 5931202 |
| chr_2 | g4912 | g4912.t1 | exon | g4912.t1.exon3 | 5931267 | 5931297 |
| chr_2 | g4912 | g4912.t1 | cds | g4912.t1.CDS3 | 5931267 | 5931297 |
| chr_2 | g4912 | g4912.t1 | exon | g4912.t1.exon4 | 5931353 | 5931459 |
| chr_2 | g4912 | g4912.t1 | cds | g4912.t1.CDS4 | 5931353 | 5931459 |
| chr_2 | g4912 | g4912.t1 | TTS | g4912.t1 | 5931524 | 5931524 |
Sequences
>g4912.t1 Gene=g4912 Length=279
ATGCACAAGACTCAATTGCTCTATTCGAAGGGAAATTTTTGTGAAAATTATTGCATATTA
ACGATGGCAGGAAATCAAGCACATCAAAATATCTCACCAAATTTGCCAGAAGGCTTGCGA
CGAAACATGGAACATTTTCAAGCTAAAAACAATATTCCAATTCATTTGAAAGGTGGACCA
CTTGACAGAATTCTTTTTGGCTCAACTGTTGTCCTTTGCGGCGTTGGTGTTGTCATGTTG
GCAAACTTCATCTATTCCATGGCTAAGAAGAAGGAATAA
>g4912.t1 Gene=g4912 Length=92
MHKTQLLYSKGNFCENYCILTMAGNQAHQNISPNLPEGLRRNMEHFQAKNNIPIHLKGGP
LDRILFGSTVVLCGVGVVMLANFIYSMAKKKE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g4912.t1 | Gene3D | G3DSA:4.10.91.10 | Cytochrome C Oxidase | 37 | 91 | 2.0E-14 |
| 1 | g4912.t1 | PANTHER | PTHR10510 | CYTOCHROME C OXIDASE POLYPEPTIDE 7A | 21 | 91 | 9.7E-18 |
| 2 | g4912.t1 | PANTHER | PTHR10510:SF13 | CYTOCHROME C OXIDASE SUBUNIT 7A-LIKE-RELATED | 21 | 91 | 9.7E-18 |
| 7 | g4912.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 63 | - |
| 8 | g4912.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 85 | - |
| 6 | g4912.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 86 | 92 | - |
| 4 | g4912.t1 | SUPERFAMILY | SSF81419 | Mitochondrial cytochrome c oxidase subunit VIIa | 36 | 90 | 7.19E-15 |
| 3 | g4912.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 86 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0009055 | electron transfer activity | MF |
| GO:0004129 | cytochrome-c oxidase activity | MF |
| GO:0005746 | mitochondrial respirasome | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
