| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5012 | g5012.t3 | TSS | g5012.t3 | 6444628 | 6444628 |
| chr_2 | g5012 | g5012.t3 | isoform | g5012.t3 | 6445003 | 6449697 |
| chr_2 | g5012 | g5012.t3 | exon | g5012.t3.exon1 | 6445003 | 6445052 |
| chr_2 | g5012 | g5012.t3 | cds | g5012.t3.CDS1 | 6445003 | 6445052 |
| chr_2 | g5012 | g5012.t3 | exon | g5012.t3.exon2 | 6449432 | 6449697 |
| chr_2 | g5012 | g5012.t3 | cds | g5012.t3.CDS2 | 6449432 | 6449696 |
| chr_2 | g5012 | g5012.t3 | TTS | g5012.t3 | 6449671 | 6449671 |
>g5012.t3 Gene=g5012 Length=316
ATGGGCTCAAGACAAGTGGTAGCCAATAAAATGGCAAATCCACAATCATGGTGGTACTTA
GCATTATTAATCTCATTTATGATTGTAAATACAAGTGCTCAAATGTGGAATGAAGTAGAG
AGCAGTGGTATAGGATTAACAGGAAGATCGAGGAATAGGCAGCCATTTAGAGAAAATGTA
CAAAGAGTGCCAGACTCTTATGATATTGTAGACACTGCCAGTGCACAAGTCAGAGGCCCA
CCTGCTAAAAATTGTACAGGCTCTGGTTGTTGTATACCAAAATGTTTTGCAGAAAAAGGA
AATAGAGGATTACCAG
>g5012.t3 Gene=g5012 Length=105
MGSRQVVANKMANPQSWWYLALLISFMIVNTSAQMWNEVESSGIGLTGRSRNRQPFRENV
QRVPDSYDIVDTASAQVRGPPAKNCTGSGCCIPKCFAEKGNRGLP
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g5012.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 15 | - |
| 5 | g5012.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 16 | 33 | - |
| 3 | g5012.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 34 | 105 | - |
| 2 | g5012.t3 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 33 | - |
| 1 | g5012.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 17 | 36 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5012/g5012.t3; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5012.t3.fa.iupred3.txt does not exist
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed