| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5019 | g5019.t7 | TSS | g5019.t7 | 6477811 | 6477811 |
| chr_2 | g5019 | g5019.t7 | isoform | g5019.t7 | 6478023 | 6478848 |
| chr_2 | g5019 | g5019.t7 | exon | g5019.t7.exon1 | 6478023 | 6478180 |
| chr_2 | g5019 | g5019.t7 | exon | g5019.t7.exon2 | 6478236 | 6478390 |
| chr_2 | g5019 | g5019.t7 | cds | g5019.t7.CDS1 | 6478262 | 6478390 |
| chr_2 | g5019 | g5019.t7 | exon | g5019.t7.exon3 | 6478452 | 6478666 |
| chr_2 | g5019 | g5019.t7 | cds | g5019.t7.CDS2 | 6478452 | 6478666 |
| chr_2 | g5019 | g5019.t7 | exon | g5019.t7.exon4 | 6478728 | 6478848 |
| chr_2 | g5019 | g5019.t7 | cds | g5019.t7.CDS3 | 6478728 | 6478848 |
| chr_2 | g5019 | g5019.t7 | TTS | g5019.t7 | 6479061 | 6479061 |
>g5019.t7 Gene=g5019 Length=649
CAGAGTAAATTGTTCATTTTACTTCAAAATAGGAGCATGTCGTCACGGAGATAGATGTTC
TCGCATTCACAATAAACCAACATTCTCACAAACGGTTCTTTTGCAAAATTTATATGTAAA
TCCACAAAATTCTGCAAAATCTGCCGATGGCTCTCACTTGGTTGCAAATGTTTCTGATGA
GGAAATGCAAGAGCATTATGATAATTTCTTTGAAGATGTGTTTGTAGAGCTTGAAGACAA
GTATGGAGAAATTGAAGAGATGAATGTTTGCGATAATCTAGGAGATCATCTTGTTGGAAA
TGTTTACATTAAATTTCGACGTGAAGAAGATGCTGAAAGAGCAGCAAAAGAACTGAATAA
TCGTTGGTTTGGTGGACGACCAGTGTATGCAGAATTATCTCCCGTTACTGACTTTCGAGA
AGCATGTTGTCGTCAATATGAAATGGGTGAATGCACTCGCTCTGGTTTTTGTAATTTCAT
GCATTTGAAACCAATATCTCGTGAGCTTCGTCGTTATTTGTATTCTAGACGAAGAGGTCG
TTCACGCTCAAGATCAAAATCACCAAGGCGTCGATCAAGATCAAGAAATCGTGATCGTCA
TTCAAGAGACAGAGACCGTGGAGATAGAGATCGTCGGGGACGTTATTAA
>g5019.t7 Gene=g5019 Length=154
MQEHYDNFFEDVFVELEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAERAAKELNNR
WFGGRPVYAELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRGRS
RSRSKSPRRRSRSRNRDRHSRDRDRGDRDRRGRY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g5019.t7 | Gene3D | G3DSA:3.30.70.330 | - | 1 | 73 | 1.2E-28 |
| 12 | g5019.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 115 | 154 | - |
| 14 | g5019.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 115 | 136 | - |
| 13 | g5019.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 137 | 154 | - |
| 3 | g5019.t7 | PANTHER | PTHR12620:SF11 | SPLICING FACTOR U2AF 35 KDA SUBUNIT-RELATED | 1 | 152 | 2.2E-74 |
| 4 | g5019.t7 | PANTHER | PTHR12620 | U2 SNRNP AUXILIARY FACTOR, SMALL SUBUNIT | 1 | 152 | 2.2E-74 |
| 6 | g5019.t7 | PRINTS | PR01848 | U2 auxiliary factor small subunit signature | 2 | 17 | 7.6E-36 |
| 7 | g5019.t7 | PRINTS | PR01848 | U2 auxiliary factor small subunit signature | 31 | 53 | 7.6E-36 |
| 8 | g5019.t7 | PRINTS | PR01848 | U2 auxiliary factor small subunit signature | 58 | 82 | 7.6E-36 |
| 5 | g5019.t7 | PRINTS | PR01848 | U2 auxiliary factor small subunit signature | 93 | 105 | 7.6E-36 |
| 1 | g5019.t7 | Pfam | PF00076 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 18 | 67 | 2.1E-6 |
| 2 | g5019.t7 | Pfam | PF00642 | Zinc finger C-x8-C-x5-C-x3-H type (and similar) | 77 | 101 | 9.8E-6 |
| 16 | g5019.t7 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 1 | 74 | 10.65 |
| 15 | g5019.t7 | ProSiteProfiles | PS50103 | Zinc finger C3H1-type profile. | 76 | 103 | 10.906 |
| 11 | g5019.t7 | SMART | SM00361 | rrm2_1 | 1 | 70 | 1.9E-16 |
| 9 | g5019.t7 | SUPERFAMILY | SSF54928 | RNA-binding domain, RBD | 6 | 77 | 1.88E-17 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5019/g5019.t7; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5019.t7.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046872 | metal ion binding | MF |
| GO:0003723 | RNA binding | MF |
| GO:0089701 | U2AF complex | CC |
| GO:0000398 | mRNA splicing, via spliceosome | BP |
| GO:0003676 | nucleic acid binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.