General information for g5091.t5
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Serine/threonine-protein kinase grp.
Parent gene
- The parent gene g5091 is located on chr_2: 6844251..6844872 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5091 | g5091.t5 | TSS | g5091.t5 | 6840236 | 6840236 |
| chr_2 | g5091 | g5091.t5 | isoform | g5091.t5 | 6840504 | 6841107 |
| chr_2 | g5091 | g5091.t5 | exon | g5091.t5.exon1 | 6840504 | 6840592 |
| chr_2 | g5091 | g5091.t5 | cds | g5091.t5.CDS1 | 6840504 | 6840592 |
| chr_2 | g5091 | g5091.t5 | exon | g5091.t5.exon2 | 6840681 | 6840904 |
| chr_2 | g5091 | g5091.t5 | cds | g5091.t5.CDS2 | 6840681 | 6840904 |
| chr_2 | g5091 | g5091.t5 | exon | g5091.t5.exon3 | 6840991 | 6841107 |
| chr_2 | g5091 | g5091.t5 | cds | g5091.t5.CDS3 | 6840991 | 6841106 |
| chr_2 | g5091 | g5091.t5 | TTS | g5091.t5 | 6841634 | 6841634 |
Sequences
>g5091.t5 Gene=g5091 Length=430
ATGACATCACAAGGCTCGAGCGAGGTAACTCGGGAATTTGTTGAAAATTGGAATCTATGT
CAGACCCTTGGAGAAGGAGCTTATGGAGAAGTTAAACTTTTAATTAATAAAAACACGAGT
GAAGCTATAGCTATGAAAATGGTAGATTTAGAGAGACATCCAGATGCTATGGCATCAGTT
AAGAAAGAAGTATGCATACAGAAAATTCTCTCTCATAAGCACATTTTAAAGTTCTATGGC
AAACGCTCACAAAACAATATTGAGTACATATTTCTTGAATATGCAGCGGGTGGAGAGTTG
TTTGATCGAATCGAACCTGATGTTGGCATGGAAATTACTCAAGCTCAACGATATTTCAAT
CAAATATTAGCCGGTGTTGAATATTTACACAAAAGAGGAATAGCACATCGAGATTTGAAA
CCTGAAAATA
>g5091.t5 Gene=g5091 Length=143
MTSQGSSEVTREFVENWNLCQTLGEGAYGEVKLLINKNTSEAIAMKMVDLERHPDAMASV
KKEVCIQKILSHKHILKFYGKRSQNNIEYIFLEYAAGGELFDRIEPDVGMEITQAQRYFN
QILAGVEYLHKRGIAHRDLKPEN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g5091.t5 | Gene3D | G3DSA:3.30.200.20 | Phosphorylase Kinase; domain 1 | 9 | 101 | 7.3E-29 |
| 8 | g5091.t5 | Gene3D | G3DSA:1.10.510.10 | Transferase(Phosphotransferase) domain 1 | 102 | 143 | 4.9E-13 |
| 2 | g5091.t5 | PANTHER | PTHR24346 | MAP/MICROTUBULE AFFINITY-REGULATING KINASE | 14 | 143 | 1.9E-41 |
| 3 | g5091.t5 | PANTHER | PTHR24346:SF42 | SERINE/THREONINE-PROTEIN KINASE SIK3 | 14 | 143 | 1.9E-41 |
| 1 | g5091.t5 | Pfam | PF00069 | Protein kinase domain | 20 | 143 | 2.1E-31 |
| 6 | g5091.t5 | ProSitePatterns | PS00107 | Protein kinases ATP-binding region signature. | 23 | 46 | - |
| 9 | g5091.t5 | ProSiteProfiles | PS50011 | Protein kinase domain profile. | 17 | 143 | 25.63 |
| 5 | g5091.t5 | SMART | SM00220 | serkin_6 | 17 | 143 | 1.4E-7 |
| 4 | g5091.t5 | SUPERFAMILY | SSF56112 | Protein kinase-like (PK-like) | 9 | 143 | 6.23E-37 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5091/g5091.t5; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5091.t5.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005524 | ATP binding | MF |
| GO:0004672 | protein kinase activity | MF |
| GO:0006468 | protein phosphorylation | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed