General information for g5147.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative V-type proton ATPase subunit H.
Parent gene
- The parent gene g5147 is located on chr_2: 7283280..7284485 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5147 | g5147.t2 | TSS | g5147.t2 | 7281189 | 7281189 |
| chr_2 | g5147 | g5147.t2 | isoform | g5147.t2 | 7281299 | 7281743 |
| chr_2 | g5147 | g5147.t2 | exon | g5147.t2.exon1 | 7281299 | 7281350 |
| chr_2 | g5147 | g5147.t2 | cds | g5147.t2.CDS1 | 7281299 | 7281350 |
| chr_2 | g5147 | g5147.t2 | exon | g5147.t2.exon2 | 7281419 | 7281681 |
| chr_2 | g5147 | g5147.t2 | cds | g5147.t2.CDS2 | 7281419 | 7281681 |
| chr_2 | g5147 | g5147.t2 | exon | g5147.t2.exon3 | 7281740 | 7281743 |
| chr_2 | g5147 | g5147.t2 | cds | g5147.t2.CDS3 | 7281740 | 7281742 |
| chr_2 | g5147 | g5147.t2 | TTS | g5147.t2 | NA | NA |
Sequences
>g5147.t2 Gene=g5147 Length=319
ATGGCCAGCAACGTCGATGACCTGATTTCATCTCATTTAGATGACAAAATTGATATGATT
GCTGCTACTAGTGTCTTACAGCAACAAGCTAGTGACATTCGAGCTCAGAAAATCAATTGG
CAATCATATCATCAATCTCAGATGATTTCGAATGAAGATTTTAATTGCATCACGGCTCTT
GATGGCGAGAAGAAAGCTCAATATTTGAAAGATAATCAGTATCAGAGCGCAAAAACCTTT
CTGAATCTTCTCAGTCATGTGTCGAAAGATACAACAATTCAATACTTGCTTGTCATGATT
GATGACTTACTTACTGAGG
>g5147.t2 Gene=g5147 Length=106
MASNVDDLISSHLDDKIDMIAATSVLQQQASDIRAQKINWQSYHQSQMISNEDFNCITAL
DGEKKAQYLKDNQYQSAKTFLNLLSHVSKDTTIQYLLVMIDDLLTE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g5147.t2 | Gene3D | G3DSA:1.25.10.10 | - | 15 | 106 | 0 |
| 2 | g5147.t2 | PANTHER | PTHR10698 | V-TYPE PROTON ATPASE SUBUNIT H | 25 | 106 | 0 |
| 1 | g5147.t2 | Pfam | PF03224 | V-ATPase subunit H | 24 | 106 | 0 |
| 3 | g5147.t2 | SUPERFAMILY | SSF48371 | ARM repeat | 17 | 105 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5147/g5147.t2; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5147.t2.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:1902600 | proton transmembrane transport | BP |
| GO:0000221 | vacuolar proton-transporting V-type ATPase, V1 domain | CC |
| GO:0046961 | proton-transporting ATPase activity, rotational mechanism | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
