| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5157 | g5157.t23 | isoform | g5157.t23 | 7349389 | 7351406 |
| chr_2 | g5157 | g5157.t23 | exon | g5157.t23.exon1 | 7349389 | 7349395 |
| chr_2 | g5157 | g5157.t23 | cds | g5157.t23.CDS1 | 7349390 | 7349395 |
| chr_2 | g5157 | g5157.t23 | exon | g5157.t23.exon2 | 7350463 | 7350606 |
| chr_2 | g5157 | g5157.t23 | cds | g5157.t23.CDS2 | 7350463 | 7350606 |
| chr_2 | g5157 | g5157.t23 | exon | g5157.t23.exon3 | 7351200 | 7351406 |
| chr_2 | g5157 | g5157.t23 | cds | g5157.t23.CDS3 | 7351200 | 7351406 |
| chr_2 | g5157 | g5157.t23 | TSS | g5157.t23 | NA | NA |
| chr_2 | g5157 | g5157.t23 | TTS | g5157.t23 | NA | NA |
>g5157.t23 Gene=g5157 Length=358
ATGCCAAAGGTTATCAAGCAAGAAGGTGAAGACCCAGATCCCTCACCATGGTTGTTCGTC
TCACTCGAACAAAAGCGTATCGATCAATCGAAACCATACGATGCCAAGAAAGCCTGCTGG
GTTCCAGATGAAAAGGAGGGCTACGTCTTGGGTGAAATTAAGTCAACCAAGGGAGACTTA
GTCACCGTTTCTGTTCCCGGTGGCGAGACTAAGGATTTAAAGAAAGACTTGGTTGCACAA
GTCAACCCTCCAAAGTACGAAAAATGCGAGGACATGTCTAACTTGACATACCTCAACGAT
GCCTCGGTTCTCCATAACTTGAGACAACGTTATCTTGCCAAACTTATCTACACCTACT
>g5157.t23 Gene=g5157 Length=119
MPKVIKQEGEDPDPSPWLFVSLEQKRIDQSKPYDAKKACWVPDEKEGYVLGEIKSTKGDL
VTVSVPGGETKDLKKDLVAQVNPPKYEKCEDMSNLTYLNDASVLHNLRQRYLAKLIYTY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g5157.t23 | Gene3D | G3DSA:2.30.30.360 | Myosin S1 fragment | 32 | 82 | 0.000 |
| 5 | g5157.t23 | Gene3D | G3DSA:3.40.850.10 | Kinesin | 83 | 119 | 0.000 |
| 2 | g5157.t23 | PANTHER | PTHR45615:SF27 | MYOSIN HEAVY CHAIN, MUSCLE | 1 | 119 | 0.000 |
| 3 | g5157.t23 | PANTHER | PTHR45615 | MYOSIN HEAVY CHAIN, NON-MUSCLE | 1 | 119 | 0.000 |
| 1 | g5157.t23 | Pfam | PF02736 | Myosin N-terminal SH3-like domain | 36 | 75 | 0.000 |
| 8 | g5157.t23 | ProSiteProfiles | PS51844 | Myosin N-terminal SH3-like domain profile. | 34 | 83 | 18.222 |
| 7 | g5157.t23 | ProSiteProfiles | PS51456 | Myosin motor domain profile. | 87 | 119 | 18.286 |
| 4 | g5157.t23 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 39 | 119 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5157/g5157.t23; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5157.t23.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0051015 | actin filament binding | MF |
| GO:0005524 | ATP binding | MF |
| GO:0016459 | myosin complex | CC |
| GO:0003774 | cytoskeletal motor activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed