General information for g518.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g518 is located on chr_3: 3867161..3867481 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g518 | g518.t1 | isoform | g518.t1 | 3867161 | 3867481 |
| chr_3 | g518 | g518.t1 | exon | g518.t1.exon1 | 3867161 | 3867283 |
| chr_3 | g518 | g518.t1 | cds | g518.t1.CDS1 | 3867161 | 3867283 |
| chr_3 | g518 | g518.t1 | exon | g518.t1.exon2 | 3867356 | 3867481 |
| chr_3 | g518 | g518.t1 | cds | g518.t1.CDS2 | 3867356 | 3867481 |
| chr_3 | g518 | g518.t1 | TTS | g518.t1 | 3867586 | 3867586 |
| chr_3 | g518 | g518.t1 | TSS | g518.t1 | NA | NA |
Sequences
>g518.t1 Gene=g518 Length=249
ATGCTTTATCATGGTGATCATCCTTCTATTGGTATTTATTTTGCAAGCAAATATGCAGTC
ACAGCAATTGCTGAACAACATCGACAAGAATTTATCAAAGAAAAATTGAACATAAAAGTC
ACCGAGGCAGTTATGACAGAAATGGTTAATGCAACTCCAAATTATCCTCAAGAACTCATG
GATGAATTAATTAAAAATACACCATTTTTGGAATCGAAAGACATTGCTGATGCCATTTAT
TATTTTTGA
>g518.t1 Gene=g518 Length=82
MLYHGDHPSIGIYFASKYAVTAIAEQHRQEFIKEKLNIKVTEAVMTEMVNATPNYPQELM
DELIKNTPFLESKDIADAIYYF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g518.t1 | Gene3D | G3DSA:3.40.50.720 | - | 2 | 82 | 9.0e-06 |
| 1 | g518.t1 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains | 7 | 81 | 2.3e-06 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g518/g518.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g518.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed