| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5186 | g5186.t1 | TTS | g5186.t1 | 7556668 | 7556668 |
| chr_2 | g5186 | g5186.t1 | isoform | g5186.t1 | 7567919 | 7568299 |
| chr_2 | g5186 | g5186.t1 | exon | g5186.t1.exon1 | 7567919 | 7568299 |
| chr_2 | g5186 | g5186.t1 | cds | g5186.t1.CDS1 | 7567919 | 7568299 |
| chr_2 | g5186 | g5186.t1 | TSS | g5186.t1 | NA | NA |
>g5186.t1 Gene=g5186 Length=381
ATGGTGGTAAAGGCCAAGAACAGAGAGAATAACGCCCTTGCTTCTCTTAAAAATGGATCA
AAAGATATTTTGGTCGCAACAGATGTGGCAGGTCGTAGGATCGATATTAAAGATGTATCA
ATGGTTATTAATTATGATATGGCCAAGACAATTGAAGATTACACACACAGAATTGGTAGA
ACTGGTCGCGCTGGAAAAACTGGAAAAGCTATCACGTTCATTACTAAAGATGACAGCACT
ATTCTACGATTTGAAACAACTTATTATGAGCAGTCCATTTCAAATTGTCCACCAGAGCTA
ATGAATCATCCTGATGCACAGCATAAACCTGGAACTGTTATAACTAAAAAGCGAAGAGAG
GAGAAAAATTTGCTGAGATAA
>g5186.t1 Gene=g5186 Length=126
MVVKAKNRENNALASLKNGSKDILVATDVAGRRIDIKDVSMVINYDMAKTIEDYTHRIGR
TGRAGKTGKAITFITKDDSTILRFETTYYEQSISNCPPELMNHPDAQHKPGTVITKKRRE
EKNLLR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g5186.t1 | CDD | cd18787 | SF2_C_DEAD | 10 | 74 | 3.70069E-35 |
| 5 | g5186.t1 | Gene3D | G3DSA:3.40.50.300 | - | 4 | 125 | 4.1E-33 |
| 9 | g5186.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 98 | 126 | - |
| 8 | g5186.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 110 | 126 | - |
| 2 | g5186.t1 | PANTHER | PTHR47958 | ATP-DEPENDENT RNA HELICASE DBP3 | 7 | 119 | 2.1E-53 |
| 3 | g5186.t1 | PANTHER | PTHR47958:SF96 | ATP-DEPENDENT RNA HELICASE DDX23-RELATED | 7 | 119 | 2.1E-53 |
| 1 | g5186.t1 | Pfam | PF00271 | Helicase conserved C-terminal domain | 6 | 65 | 2.8E-18 |
| 10 | g5186.t1 | ProSiteProfiles | PS51194 | Superfamilies 1 and 2 helicase C-terminal domain profile. | 1 | 104 | 15.717 |
| 7 | g5186.t1 | SMART | SM00490 | helicmild6 | 1 | 65 | 2.5E-11 |
| 4 | g5186.t1 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 8 | 89 | 7.15E-27 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5186/g5186.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5186.t1.fa.iupred3.txt does not exist
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.